SecReT4
Protein ID: 188591498
T4SS name [ID]Trb [780]
Gene symboltrbG
Locus tagpRALTA_0216
StrainCupriavidus taiwanensis LMG 19424
Repliconplasmid pRALTA [GenBank: NC_010529] [Browse all T4SS(s) in this replicon]
Location [Strand]183178..184089 [-]
Producttype IV secretion system, conjugation protein
Component typeTrbG
UniProt IDB2AK67
KEGG IDcti:pRALTA_0216
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 7.3e-52, Aligned region: 71..294
Protein Sequence: 303 a.a.     [Download]
>gi|188591498|ref|YP_001796097.1| type IV secretion system, conjugation protein [Cupriavidus taiwanensis]
MEARTPSRVLPLVIALGLALLLSIPDGHAADKTGRRPGAGIAGLGIGDLSDAMNPGNPFNGGVDPIALPG
DSRLVVFTYSRDQIFRVLSAPLKVTTIEFPDDEQIVGDPAWGENVRWDYDTDGANHLYVKPQAAGLVNTL
SVNTNKRSYEFTLVSSPLGGIFYQKVRFRIPTSISAKVKARNDSRSEQADNAKATEGGDSRNVDAVAVPP
DQLNFEYAISGSASFKPETAFDDGKALWLRLPAAALQSWPVALVKDGSDFVVVNQIRRGGYLVVQRLADT
VVLRSGDDEVRIERGRRRVLGLF
 
Nucleotide Sequence: 912 bp     [Download]
>gi|188591327|ref|NC_010529.1|:c184089-183178 Cupriavidus taiwanensis plasmid pRALTA, complete sequence
ATGGAAGCCCGTACCCCCTCCCGAGTTCTCCCGCTGGTCATCGCCCTTGGCCTGGCACTGTTGCTTTCCA
TTCCGGATGGCCACGCTGCGGACAAGACTGGGCGCCGTCCTGGCGCTGGCATTGCCGGGCTGGGTATCGG
CGACCTGAGCGACGCCATGAATCCGGGGAATCCGTTCAATGGCGGTGTCGATCCTATCGCGCTGCCGGGT
GACTCTCGGCTCGTGGTGTTCACGTACAGCCGGGACCAAATTTTCCGGGTGCTGAGCGCGCCATTGAAGG
TCACGACCATCGAGTTTCCGGACGACGAGCAGATCGTTGGCGACCCGGCCTGGGGCGAGAACGTACGTTG
GGACTATGACACCGATGGCGCCAACCATCTCTACGTGAAGCCGCAGGCGGCGGGCCTCGTCAATACGCTG
TCGGTGAACACGAACAAGCGCAGCTACGAGTTCACGCTGGTGTCGTCGCCTCTGGGCGGTATCTTTTACC
AGAAGGTGCGATTCCGCATTCCGACGTCGATCTCGGCCAAGGTCAAGGCCCGCAATGACTCGCGTAGCGA
GCAGGCGGACAATGCGAAGGCGACAGAGGGGGGCGATTCGCGTAACGTCGACGCCGTGGCGGTGCCACCG
GACCAGCTGAATTTCGAATACGCCATTTCGGGAAGCGCCAGCTTCAAGCCGGAGACCGCTTTCGACGATG
GCAAGGCGCTATGGCTACGGTTACCTGCCGCCGCGCTTCAGAGCTGGCCGGTCGCCCTGGTGAAGGACGG
CAGCGACTTCGTGGTGGTGAACCAGATCCGTCGCGGCGGCTATCTGGTGGTCCAGCGTCTGGCCGATACC
GTTGTGCTGCGCTCCGGCGACGATGAAGTCAGGATCGAGCGTGGCCGTCGTCGCGTGTTGGGGCTGTTCT
GA
 Primer design