SecReT4
Protein ID: 188591501
T4SS name [ID]Trb [780]
Gene symbol-
Locus tagpRALTA_0219
StrainCupriavidus taiwanensis LMG 19424
Repliconplasmid pRALTA [GenBank: NC_010529] [Browse all T4SS(s) in this replicon]
Location [Strand]186235..186582 [+]
Productconserved hypothetical protein; putative trbC/virB2 homolog
Component typeTrbC
UniProt IDB2AK70
KEGG IDcti:pRALTA_0219
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.3e-08, Aligned region: 13..106
Protein Sequence: 115 a.a.     [Download]
>gi|188591501|ref|YP_001796100.1| conserved hypothetical protein; putative trbC/virB2 homolog [Cupriavidus taiwanensis]
MTPQFSLRARATARKYAPSVLLLVGMMAVATSAAAADDSFLGNLGNFICGIATFINTKYLFVIGLIVIVL
GAYAYANAESSLSKFISGACVGVGLAAAAPSILKTLNIVAACTGF
 
Nucleotide Sequence: 348 bp     [Download]
>gi|188591327|ref|NC_010529.1|:186235-186582 Cupriavidus taiwanensis plasmid pRALTA, complete sequence
ATGACCCCCCAGTTCTCCCTGCGCGCCCGCGCCACCGCACGCAAGTACGCGCCTTCCGTCCTGTTGCTCG
TCGGCATGATGGCGGTGGCCACCTCCGCCGCCGCCGCGGACGATTCGTTCCTCGGCAATCTCGGCAACTT
CATCTGTGGCATCGCCACCTTCATCAACACCAAGTACCTCTTCGTCATTGGCCTGATCGTCATCGTGCTC
GGCGCGTACGCCTATGCCAATGCGGAGTCGAGCCTGTCCAAGTTCATTTCGGGGGCGTGCGTGGGCGTCG
GCCTCGCCGCGGCGGCACCGTCGATCCTCAAGACGCTGAATATTGTGGCCGCCTGCACCGGCTTCTGA
 Primer design