SecReT4
Protein ID: 188591505
T4SS name [ID]Trb [780]
Gene symboltrbL
Locus tagpRALTA_0223
StrainCupriavidus taiwanensis LMG 19424
Repliconplasmid pRALTA [GenBank: NC_010529] [Browse all T4SS(s) in this replicon]
Location [Strand]190148..191203 [+]
ProductType IV secretory pathway, conjugal transfert protein, putative permease
Component typeTrbL
UniProt IDB2AK74
KEGG IDcti:pRALTA_0223
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5.7e-27, Aligned region: 97..317
Protein Sequence: 351 a.a.     [Download]
>gi|188591505|ref|YP_001796104.1| Type IV secretory pathway, conjugal transfert protein, putative permease [Cupriavidus taiwanensis]
MNAMLLRLLVLLVTAVLLHTAPAFAQSTSAEAGSPSQSVESAQTPPSFSGPTGTVAESLKSWIGQFDSFR
TGLIGGATSLSQSIRSETDKVAYGLALITLTLAAIRFAATNDPTSAWNDILETIMVLGILASIYVGYSQF
APGIYDWFTTLANKIAGTRSSNPAMTLISVGAGFLDSYNQAMDAASGLSKLGVAVSGLTLLFTFVVCAVA
ALMYSFFIALGEIQAAVGIVIGPLAVALAFSDYTRRYFMSWLDFMIGASMYIVISTIMARLVSSAFTSTI
ADQTGIGTKSLAGAAYALGVALFMLLVALEIPKMSGAVFGSGGGLSGGAAARLGMKAAGGIGGFLAKKGK
K
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|188591327|ref|NC_010529.1|:190148-191203 Cupriavidus taiwanensis plasmid pRALTA, complete sequence
ATGAACGCCATGCTGCTGCGCCTACTGGTTCTGCTTGTCACCGCGGTGCTCTTGCACACCGCCCCGGCCT
TTGCTCAGTCAACGAGTGCCGAAGCCGGGTCCCCTTCCCAGTCCGTGGAGTCTGCCCAGACCCCGCCGTC
TTTCTCGGGTCCGACGGGCACTGTTGCCGAATCCCTCAAAAGTTGGATTGGGCAGTTCGATTCCTTCCGC
ACCGGCCTGATTGGGGGCGCCACCTCACTCAGTCAGAGCATACGATCGGAGACGGACAAGGTGGCATACG
GATTGGCGCTCATTACGCTGACGCTTGCCGCCATCCGGTTCGCCGCCACGAATGATCCAACCAGCGCATG
GAACGACATCCTGGAAACCATCATGGTGCTCGGCATTCTCGCCTCGATCTATGTGGGATACAGCCAATTT
GCGCCGGGCATCTATGATTGGTTCACGACACTCGCCAACAAGATCGCCGGTACGCGGTCCAGCAATCCGG
CGATGACCCTCATCTCGGTGGGCGCGGGATTCCTGGACTCGTACAACCAGGCGATGGACGCGGCAAGCGG
TCTGAGCAAGCTCGGCGTGGCGGTTTCGGGATTGACTCTTCTCTTTACGTTCGTGGTCTGCGCGGTGGCA
GCGCTGATGTACAGCTTCTTCATCGCCTTGGGTGAGATTCAGGCCGCTGTGGGTATCGTGATCGGCCCCC
TTGCAGTAGCCCTGGCGTTCTCCGACTACACACGGCGCTATTTCATGTCGTGGCTCGATTTCATGATCGG
CGCTTCGATGTATATCGTCATCTCAACCATCATGGCGCGACTCGTTTCAAGCGCTTTCACTTCCACGATC
GCTGATCAGACTGGCATTGGCACGAAATCTTTGGCTGGCGCCGCCTATGCCCTTGGTGTTGCCTTGTTCA
TGCTGCTGGTCGCACTCGAGATTCCCAAGATGTCGGGTGCGGTCTTTGGATCGGGGGGTGGTCTTAGCGG
TGGCGCCGCGGCTCGCCTGGGTATGAAGGCAGCTGGCGGCATCGGTGGGTTCCTCGCCAAGAAGGGCAAG
AAATGA
 Primer design