SecReT4
Protein ID: 188991072
T4SS name [ID]VirB [406]
Gene symbolvirD4
Locus tagxccb100_1676
StrainXanthomonas campestris pv. campestris str. B100
Repliconchromosome [GenBank: NC_010688] [Browse all T4SS(s) in this replicon]
Location [Strand]1928821..1930494 [+]
Producttype IV secretion system coupling protein VirD4
Component typeVirD4
UniProt IDB0RRE1
KEGG IDxca:xccb100_1676
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 9.1e-112, Aligned region: 108..552
TraG-D_C [PF12696], Evalue: 1.1e-28, Aligned region: 398..511
TrwB_AAD_bind [PF10412], Evalue: 5.5e-24, Aligned region: 182..517
Protein Sequence: 557 a.a.     [Download]
>gi|188991072|ref|YP_001903082.1| type IV secretion system coupling protein VirD4 [Xanthomonas campestris pv. campestris str. B100]
MSKLKIAAIATVVTMLIGYCLSGYLTLLLLRLDTKLYAWDTYYRYVSAMGLPEVAPYVTKIKLAGAFGFG
LPGIVWAIGMVLLVKPKQKALHGDARFAGAADLSKHGLFKPSPNGIVVGKFNGKLVRLSGQQFVILAAPT
RSGKGVGVVIPNLLEYQESVVVLDIKQENFDLTSGWRASQGHEVFLFNPFAEDRRTHRWNPLTYVSADPA
FRVSDLMSIAAMLYPDGSDDQKFWVSQARNAFMAFSLYLFENWDEELSLGFPGGAGAPTLGGIYRLSSGD
GTDLKKYLKSLSERRFLSSNAKSAFANMLSQADETFASIMGTLKEPLNAWINPVLDAATSADDFLLTDLR
KKKMTIYIGIQPNKLAESRLIINLLFSQIINLNTRELPKSNPELKYQCLLLMDEFTSIGKVDIISTAVAY
MAGYNIRLLPIIQSMAQLDATYGKDLSRTIITNHALQILYAPREQQDANDYSEMLGYTTIKKKNVTRGRE
TTHSVSEERRALMLPQELKAMGNEKEVFLYEGIPHPVKCDKIRYYEDRYFTARLLPKTDVKTLSVNV
 
Nucleotide Sequence: 1674 bp     [Download]
>gi|188989396|ref|NC_010688.1|:1928821-1930494 Xanthomonas campestris pv. campestris str. B100 chromosome, complete genome
GTGTCCAAGCTCAAAATCGCCGCAATCGCCACCGTGGTGACGATGCTCATCGGGTATTGCCTGTCGGGCT
ACCTGACGTTGCTGCTATTGCGGCTGGATACCAAGCTGTACGCGTGGGACACCTACTATCGCTACGTCAG
CGCCATGGGTCTTCCGGAGGTTGCGCCGTACGTGACCAAGATCAAGTTGGCTGGGGCGTTCGGTTTCGGC
CTGCCGGGTATCGTCTGGGCAATCGGCATGGTGCTGCTGGTCAAACCCAAGCAGAAGGCGCTGCATGGCG
ACGCGCGCTTTGCGGGCGCTGCCGATCTTTCCAAGCACGGGCTGTTCAAGCCAAGCCCGAATGGCATCGT
AGTCGGCAAGTTCAATGGCAAGTTGGTCCGGCTCAGTGGCCAGCAGTTCGTCATCCTCGCCGCGCCGACG
CGCTCCGGTAAAGGCGTGGGCGTGGTCATTCCAAATCTGCTTGAGTACCAGGAATCGGTGGTGGTCCTGG
ACATCAAGCAGGAAAACTTCGATCTGACCAGCGGCTGGCGTGCCAGCCAGGGGCACGAGGTTTTTCTCTT
CAATCCGTTTGCCGAAGATCGCCGCACGCACCGCTGGAACCCGCTCACCTACGTGTCGGCTGATCCGGCC
TTCCGCGTCTCGGATCTGATGAGCATCGCCGCGATGCTGTACCCGGACGGTTCGGACGATCAGAAATTCT
GGGTCAGCCAGGCGCGCAACGCGTTCATGGCGTTCTCGCTTTATCTGTTCGAAAACTGGGACGAGGAGCT
GTCGCTGGGCTTCCCGGGCGGGGCAGGGGCGCCTACGTTGGGTGGAATCTACCGTCTCTCGTCGGGTGAC
GGCACCGACCTCAAGAAATATCTGAAGTCGCTGTCCGAACGCAGGTTCCTCAGCAGCAACGCCAAGTCGG
CGTTTGCCAACATGCTGTCACAGGCGGATGAGACTTTCGCCTCCATCATGGGCACCCTGAAAGAGCCGCT
CAACGCCTGGATCAATCCCGTCCTGGACGCTGCTACCAGCGCCGACGATTTCCTGCTGACGGATCTGCGC
AAGAAGAAGATGACCATCTACATCGGCATCCAGCCCAACAAGCTGGCCGAGAGTCGCCTGATCATCAATC
TGCTTTTCAGCCAGATCATCAACCTCAACACCCGCGAACTGCCCAAGTCCAACCCTGAGCTCAAGTACCA
GTGCCTGTTGCTGATGGACGAGTTCACCTCGATCGGCAAGGTGGACATCATCTCCACCGCCGTGGCCTAC
ATGGCCGGCTACAACATCCGTCTGCTGCCCATCATCCAGAGCATGGCGCAGCTGGACGCCACCTACGGCA
AGGACCTCTCGCGCACCATCATCACCAACCACGCCCTGCAGATCCTCTACGCCCCGCGCGAGCAGCAGGA
CGCGAATGACTACTCCGAGATGCTGGGGTACACCACCATCAAGAAGAAGAACGTCACCAGAGGCCGTGAG
ACGACCCATAGCGTTTCCGAGGAGCGCCGGGCGCTGATGTTGCCGCAGGAGCTCAAGGCCATGGGCAACG
AGAAGGAAGTCTTCCTATACGAAGGAATCCCGCATCCTGTGAAGTGCGACAAGATCCGCTACTACGAAGA
CCGGTACTTCACGGCACGGCTGCTGCCGAAAACGGATGTGAAAACGCTTTCTGTCAATGTGTGA
 Primer design