SecReT4
Protein ID: 188991074
T4SS name [ID]VirB [406]
Gene symbolptlE
Locus tagxccb100_1678
StrainXanthomonas campestris pv. campestris str. B100
Repliconchromosome [GenBank: NC_010688] [Browse all T4SS(s) in this replicon]
Location [Strand]1931384..1932391 [+]
ProductVirB8-like type IV secretion system protein PtlE
Component typeVirB8
UniProt IDB0RRE3
KEGG IDxca:xccb100_1678
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.2e-56, Aligned region: 21..241
Protein Sequence: 335 a.a.     [Download]
>gi|188991074|ref|YP_001903084.1| VirB8-like type IV secretion system protein PtlE [Xanthomonas campestris pv. campestris str. B100]
MLRKKVSEKDGSAQVGAAVQKAVNYEVSIADLARRSEKRAWIVATLSMVVTVMTAGGYYYMLPLKEKVPY
LVMADAYSGTSTIAKLEANFGGRTITTSEALARSNIARFIIARESFDLSIIGQRDWNTVSAMGTTNVVNE
YRALHSSNNPLRPLNTYGKLRAVRVNILSITLIGGKGQPYKGATVRFQRTVYDKNSTLSTLLDNKIATMG
FVYQDNLEMSDSLRVENPLGFRVTDYRVDNDYSSLPAAPATGAVINAQPQAAAQQPGIGVVDPNAANVSG
AIPQGGVPLQQGALPQGGVPQQQAQPAFPDQMQPAGQPAIQPQGTPNNVNGASGR
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|188989396|ref|NC_010688.1|:1931384-1932391 Xanthomonas campestris pv. campestris str. B100 chromosome, complete genome
ATGTTGCGTAAGAAGGTCAGTGAGAAAGATGGATCTGCCCAAGTCGGGGCGGCCGTCCAAAAGGCGGTTA
ATTACGAGGTGAGCATCGCTGATCTTGCGCGCCGCAGTGAAAAGCGCGCGTGGATTGTGGCGACCTTGTC
GATGGTCGTGACCGTCATGACTGCGGGCGGCTATTACTACATGCTGCCGTTGAAGGAGAAAGTGCCCTAT
CTAGTTATGGCAGATGCCTATTCGGGTACAAGCACTATCGCCAAGCTTGAAGCGAATTTTGGTGGGAGAA
CGATTACTACGAGTGAGGCCTTGGCGCGTAGCAATATCGCACGCTTCATCATTGCCCGCGAATCGTTTGA
TTTGTCGATCATCGGTCAACGTGACTGGAATACCGTGTCGGCAATGGGAACGACAAATGTTGTGAATGAA
TATCGCGCACTGCATTCTTCAAACAATCCGCTACGGCCGTTGAATACGTACGGCAAGCTTCGCGCAGTCC
GCGTCAATATCCTAAGTATCACGCTGATCGGCGGGAAGGGGCAGCCCTACAAAGGTGCGACCGTGCGCTT
CCAGCGGACCGTATATGACAAGAATTCAACGCTCTCCACGCTGCTCGATAACAAGATCGCCACCATGGGC
TTCGTCTATCAGGACAATCTGGAGATGAGTGATAGCTTGCGTGTCGAAAATCCCCTGGGATTCCGGGTGA
CAGATTATCGGGTCGATAACGACTATTCCTCGCTGCCAGCAGCGCCTGCCACTGGTGCTGTCATCAATGC
GCAGCCTCAGGCAGCGGCACAGCAGCCTGGCATAGGCGTTGTCGATCCCAACGCGGCAAATGTCTCCGGT
GCGATTCCGCAAGGGGGCGTTCCGCTCCAGCAAGGAGCATTGCCGCAGGGGGGCGTGCCGCAACAGCAAG
CACAGCCCGCGTTTCCGGATCAAATGCAGCCGGCGGGTCAGCCTGCGATTCAACCCCAAGGGACGCCGAA
TAATGTCAATGGAGCAAGCGGTCGATGA
 Primer design