SecReT4
Protein ID: 188991077
T4SS name [ID]VirB [406]
Gene symbolvirB11
Locus tagxccb100_1681
StrainXanthomonas campestris pv. campestris str. B100
Repliconchromosome [GenBank: NC_010688] [Browse all T4SS(s) in this replicon]
Location [Strand]1934318..1935376 [+]
Producttype IV secretion system energizing component VirB11
Component typeVirB11
UniProt IDB0RRE6
KEGG IDxca:xccb100_1681
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.7e-62, Aligned region: 34..331
Protein Sequence: 352 a.a.     [Download]
>gi|188991077|ref|YP_001903087.1| type IV secretion system energizing component VirB11 [Xanthomonas campestris pv. campestris str. B100]
MNDVVAMTIDDSPTARISNDFLDYQYSVLGILDYLNSPDVTEICINRPGELYLETIHGWQRVDVPSLTYD
RARQFCTAVVNESNTGQRITDADPVVSLTFPTGQRAQFVMPPACDAGKVSITIRLPSKHTKSLEQYKHDG
FFDEVLEQSADVSDHDQELLELRRKRDYAEFFKKCVLYKKNVVVAGATGSGKTTFMKALVNHIPNEERLV
TIEDARELFISQPNSVHLLYSKGGQSASNVTAKSCMEACLRMKPDRIILAELRGDESFYFIRNCASGHPG
SITSCHAGSVEQTWDQLALMVKASNEGSGLEFEVIKRLLRMTIDIVVHIKAHAGRRFITGIDFDPLRTLR
GG
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|188989396|ref|NC_010688.1|:1934318-1935376 Xanthomonas campestris pv. campestris str. B100 chromosome, complete genome
GTGAATGACGTGGTTGCCATGACGATCGATGATTCCCCGACAGCACGCATCTCGAATGACTTCCTGGATT
ACCAGTACTCAGTGCTGGGAATCCTGGATTACCTGAACTCGCCTGACGTGACCGAAATCTGCATCAATCG
TCCGGGTGAGCTGTATCTTGAGACCATTCATGGGTGGCAGCGGGTTGATGTGCCGTCGCTCACTTACGAC
CGTGCTCGGCAGTTTTGTACGGCTGTCGTCAACGAGAGCAATACCGGGCAACGTATCACCGACGCCGACC
CGGTGGTATCACTGACTTTTCCGACGGGGCAGCGCGCACAGTTCGTGATGCCGCCGGCATGCGACGCCGG
CAAGGTATCCATCACGATCCGGTTGCCTTCCAAGCATACGAAGTCGCTGGAGCAGTATAAACATGACGGT
TTCTTCGACGAGGTCCTGGAACAGTCGGCCGATGTCAGCGACCATGACCAGGAGTTGCTGGAATTGCGCC
GTAAACGTGACTATGCCGAGTTCTTCAAAAAGTGCGTGCTGTACAAGAAGAATGTAGTCGTGGCTGGGGC
AACAGGCAGCGGCAAGACCACCTTCATGAAGGCACTTGTCAATCACATCCCCAACGAAGAACGTCTTGTC
ACCATCGAGGACGCGCGTGAGCTGTTCATCAGTCAGCCCAATTCCGTGCACCTGTTGTATTCGAAGGGTG
GACAGAGCGCCAGCAATGTGACTGCCAAGAGTTGCATGGAGGCATGCCTGCGCATGAAGCCGGATCGCAT
CATCCTGGCCGAGTTGCGTGGTGATGAGTCGTTCTACTTCATCCGTAACTGCGCATCGGGACATCCGGGT
TCCATCACCAGTTGCCACGCCGGTAGCGTCGAGCAGACCTGGGACCAGTTGGCCTTGATGGTGAAGGCAT
CCAACGAAGGCTCCGGTCTGGAGTTCGAAGTGATCAAGCGTTTGCTGCGAATGACGATCGACATCGTGGT
TCACATCAAGGCACACGCCGGGCGCCGGTTCATCACGGGCATCGACTTCGATCCTCTGAGAACCTTGCGC
GGCGGTTGA
 Primer design