SecReT4
Protein ID: 188991835
T4SS name [ID]Tfc [687]
Gene symbol-
Locus tagxccb100_2440
StrainXanthomonas campestris pv. campestris str. B100
Repliconchromosome [GenBank: NC_010688] [Browse all T4SS(s) in this replicon]
Location [Strand]2836212..2836793 [+]
Productlytic transglycosylase
Component typeTfc4
UniProt IDB0RTN6
KEGG IDxca:xccb100_2440
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 193 a.a.     [Download]
>gi|188991835|ref|YP_001903845.1| lytic transglycosylase [Xanthomonas campestris pv. campestris str. B100]
MPVLPHLRAVVLAAGLYACAAQAQEIPPPAYQLAAQSAGIPSSVLYAVALQESGIRRHRRVVPWPWSLNI
AGQSRRYATRADACAGLQQAMRSTPHTRIDAGLGQINLGYHQQRYASACDLLDPYRNLAIAAEILQEQHT
PGENWLVAIGRYHRPAGGEPAARYRRSVSRHLARVQGTRPTAAVLAAWQETSP
 
Nucleotide Sequence: 582 bp     [Download]
>gi|188989396|ref|NC_010688.1|:2836212-2836793 Xanthomonas campestris pv. campestris str. B100 chromosome, complete genome
ATGCCCGTCTTGCCGCACCTGCGTGCAGTGGTGCTAGCTGCGGGCCTGTACGCCTGCGCCGCCCAGGCCC
AGGAGATCCCGCCGCCGGCCTACCAGCTTGCCGCGCAGAGCGCCGGCATTCCTTCGTCGGTGCTCTACGC
CGTGGCCTTGCAGGAGAGCGGCATCCGGCGCCACAGGCGCGTCGTCCCATGGCCGTGGTCCCTCAACATC
GCCGGCCAATCGCGCCGCTATGCGACCCGCGCCGACGCCTGCGCCGGTTTGCAGCAAGCCATGCGCTCCA
CGCCGCACACGCGCATCGACGCGGGCCTGGGCCAGATTAACCTCGGCTACCACCAGCAGCGCTACGCCAG
CGCGTGCGACTTGCTCGACCCGTACCGCAATCTCGCCATCGCCGCCGAGATCCTGCAAGAGCAGCACACC
CCCGGCGAAAACTGGCTGGTGGCGATCGGCCGCTACCACCGCCCCGCCGGTGGCGAGCCCGCAGCCCGCT
ATCGGCGCAGCGTGTCCCGCCACCTCGCGCGCGTGCAGGGCACGCGCCCAACCGCCGCAGTCCTCGCCGC
GTGGCAGGAGACCTCCCCATGA
 Primer design