SecReT4
Protein ID: 188991838
T4SS name [ID]Tfc [687]
Gene symbol-
Locus tagxccb100_2443
StrainXanthomonas campestris pv. campestris str. B100
Repliconchromosome [GenBank: NC_010688] [Browse all T4SS(s) in this replicon]
Location [Strand]2839529..2840278 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDB0RTN9
KEGG IDxca:xccb100_2443
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.5e-70, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|188991838|ref|YP_001903848.1| hypothetical protein xccb100_2443 [Xanthomonas campestris pv. campestris str. B100]
MRDVASTAQREQNQSQGLIVGTLTLPFRLLGVLIGSLLFSIVVECVGMHLFWKDQGWRHSQQMLQSELGH
LSSHFTRSMVVQEPGHTAHELVDTGYEWVFVRSGLLERMSQTAERAHAPSNGQTRNFRYYISQVYVWTES
YLIAAAFTMLTFIVRLLVLVLTLPLIFTAAFVGLIDGLVRRDVRRFGAGRESSFIYHRAKASLMPLVVLP
WVTYLALPISVHPLLILLPSAALLGWAVSLTAGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|188989396|ref|NC_010688.1|:2839529-2840278 Xanthomonas campestris pv. campestris str. B100 chromosome, complete genome
ATGAGAGACGTCGCCTCAACCGCGCAACGAGAGCAGAACCAGAGCCAAGGCCTGATCGTCGGCACCCTTA
CGCTACCGTTTCGGCTGCTCGGGGTATTGATCGGCTCGCTGCTGTTTTCGATCGTCGTGGAGTGTGTCGG
CATGCACCTGTTCTGGAAGGACCAGGGATGGCGCCACTCCCAGCAGATGTTGCAGTCCGAACTGGGGCAC
CTCTCCAGTCACTTCACGCGCAGCATGGTCGTGCAGGAGCCGGGGCACACGGCACACGAGCTGGTGGATA
CCGGCTACGAATGGGTGTTCGTGCGCTCAGGCTTGTTGGAACGGATGAGCCAGACCGCCGAGCGCGCCCA
CGCGCCAAGCAACGGACAGACGCGCAACTTTCGCTACTACATTAGCCAAGTCTACGTCTGGACCGAGAGC
TATCTGATCGCTGCGGCCTTCACGATGCTGACCTTCATCGTGCGTCTGCTGGTCCTGGTTCTCACGCTTC
CACTGATCTTCACGGCAGCATTCGTTGGTTTGATCGACGGCCTGGTGCGGCGCGACGTGCGTCGATTCGG
TGCGGGTCGGGAATCTAGCTTTATTTATCACCGGGCAAAAGCGAGCCTGATGCCGCTGGTCGTGCTGCCT
TGGGTGACCTACCTCGCGCTGCCGATCTCAGTGCACCCGTTGCTGATCCTCTTGCCCAGCGCAGCCTTGC
TGGGCTGGGCTGTGAGTCTGACCGCCGGGAGCTTCAAAAAGTATCTCTAG
 Primer design