SecReT4
Protein ID: 188991839
T4SS name [ID]Tfc [687]
Gene symbol-
Locus tagxccb100_2444
StrainXanthomonas campestris pv. campestris str. B100
Repliconchromosome [GenBank: NC_010688] [Browse all T4SS(s) in this replicon]
Location [Strand]2840377..2840757 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDB0RTP0
KEGG IDxca:xccb100_2444
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.9e-29, Aligned region: 29..109
Protein Sequence: 126 a.a.     [Download]
>gi|188991839|ref|YP_001903849.1| hypothetical protein xccb100_2444 [Xanthomonas campestris pv. campestris str. B100]
MVASTWLRAAHRGVPTFLLTALLMGQSPMALAESPAQRQELVAALRQLDALERTVANSDAHTPITPGERY
HFDYPRLLADLARVRVGIQDHLTPSRAQPRDSSELAGDYRTEQRTELPRTTAEGEP
 
Nucleotide Sequence: 381 bp     [Download]
>gi|188989396|ref|NC_010688.1|:2840377-2840757 Xanthomonas campestris pv. campestris str. B100 chromosome, complete genome
ATGGTGGCTTCAACTTGGCTACGCGCCGCGCATCGCGGCGTGCCCACTTTTCTCTTGACGGCCCTCTTGA
TGGGGCAGTCCCCAATGGCGTTGGCCGAATCTCCGGCACAGCGCCAGGAACTGGTCGCCGCGCTGCGCCA
GCTTGATGCCCTGGAGCGCACCGTCGCGAACAGCGACGCGCATACCCCCATCACGCCGGGCGAACGCTAC
CACTTCGACTACCCGCGTCTCCTGGCTGATCTGGCGCGCGTGCGCGTCGGCATCCAGGACCACCTCACGC
CATCGCGTGCCCAGCCGCGTGATTCCTCCGAACTGGCCGGTGACTACCGCACCGAGCAGCGCACCGAGCT
GCCGCGGACGACCGCGGAGGGCGAGCCATGA
 Primer design