SecReT4
Protein ID: 188991842
T4SS name [ID]Tfc [687]
Gene symbol-
Locus tagxccb100_2447
StrainXanthomonas campestris pv. campestris str. B100
Repliconchromosome [GenBank: NC_010688] [Browse all T4SS(s) in this replicon]
Location [Strand]2841374..2841784 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDB0RTP3
KEGG IDxca:xccb100_2447
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 9.1e-49, Aligned region: 10..133
Protein Sequence: 136 a.a.     [Download]
>gi|188991842|ref|YP_001903852.1| hypothetical protein xccb100_2447 [Xanthomonas campestris pv. campestris str. B100]
MSEHQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGGAGLLVGAPLSWVFRTIALAPTFVVLG
VALGVFIGGGILRRLKRGRPDTWLYRQLQWRITMRHPLAANWVGGRTLISHSGFWSTRRSMPRGAR
 
Nucleotide Sequence: 411 bp     [Download]
>gi|188989396|ref|NC_010688.1|:2841374-2841784 Xanthomonas campestris pv. campestris str. B100 chromosome, complete genome
ATGTCCGAACACCAGCACGTCCGTGCCGACGGGACGGTGACGTTCCTTCCGCACCGGCTCAACCGCCATC
CCGTTGTTGTGCGTGGACTCACCGCCGACGAGCTGTGGATTTGCTGCGGTCTGTCCGGCGGCGCCGGCCT
GCTGGTCGGCGCGCCGCTGTCCTGGGTGTTCCGCACGATCGCACTCGCGCCCACGTTCGTCGTCCTGGGC
GTGGCCCTCGGCGTGTTCATCGGCGGCGGCATCCTCCGTCGACTCAAGCGTGGGCGGCCAGATACCTGGC
TATACCGGCAGTTGCAGTGGCGGATCACCATGCGCCATCCGCTCGCAGCCAACTGGGTGGGCGGCCGTAC
GCTGATCTCGCACTCGGGTTTCTGGTCCACCCGCAGGTCCATGCCAAGGGGGGCGCGATGA
 Primer design