SecReT4
Protein ID: 188991853
T4SS name [ID]Tfc [687]
Gene symbol-
Locus tagxccb100_2458
StrainXanthomonas campestris pv. campestris str. B100
Repliconchromosome [GenBank: NC_010688] [Browse all T4SS(s) in this replicon]
Location [Strand]2851140..2852534 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDB0RTQ4
KEGG IDxca:xccb100_2458
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 464 a.a.     [Download]
>gi|188991853|ref|YP_001903863.1| hypothetical protein xccb100_2458 [Xanthomonas campestris pv. campestris str. B100]
MKRPELMNLSTKARRLLRTTALAGALALGCGLAWAQNGFQASGPVIGDEVMYSIGGGSAVSMGRAAGMRS
IGVGAGWNSNLICGDMNIQTTLKNQLNGVTNGFQQIMSNVIQSATSAVASLPALIIQRADPGLYNLLTNG
VLQARLDFDRSKLTCRAMAEKMAETAGGQLGWSQMAQGMALRDAVSSTDAVSAIEQAETKRGNDGVPWVG
GSNAGGAGQPAIRVVGDVTRAGYNLVNGRSVTDTSSIAQASCASLSCQTWTSPQQAVEWATRVLGEKEQR
TCDACTKTETVPGVGLTPLIQEEYEAKLEALQELISGTRNTTFENLRVAGSTSLPITRGVIEALRDEPDQ
DLLARRLASEVALSSVLEKALLLQRTLLTGKKEPNVAANELAVEAVNHESDTLDREIQNLKTELELRREL
ANNSPMAIIQRHGTRAAGSRGIYEGDPVPDRLDQLQKGNPGVRP
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|188989396|ref|NC_010688.1|:2851140-2852534 Xanthomonas campestris pv. campestris str. B100 chromosome, complete genome
ATGAAGCGTCCTGAACTGATGAATCTCTCTACCAAGGCACGCCGCCTGCTGCGCACCACGGCGCTGGCCG
GCGCGCTTGCCCTGGGCTGCGGCCTCGCATGGGCGCAGAACGGCTTCCAGGCCAGCGGCCCCGTCATCGG
CGATGAGGTCATGTATTCGATTGGTGGTGGCAGCGCGGTGTCCATGGGCCGCGCGGCAGGCATGCGTTCG
ATCGGAGTCGGTGCGGGCTGGAACAGCAACCTGATCTGCGGCGACATGAACATCCAGACCACGCTGAAGA
ACCAGCTCAACGGTGTCACGAACGGCTTTCAGCAGATCATGAGCAACGTGATCCAGAGTGCTACCAGCGC
CGTGGCATCCCTGCCTGCGCTGATCATCCAGCGCGCCGATCCAGGCTTGTACAACCTGCTCACAAATGGC
GTGCTGCAGGCGCGGCTGGACTTCGACCGCTCGAAGCTGACGTGCCGCGCCATGGCCGAGAAGATGGCCG
AGACGGCCGGCGGCCAGCTTGGCTGGAGCCAGATGGCACAAGGCATGGCGCTGCGCGATGCGGTGTCTAG
CACGGATGCCGTGTCGGCGATCGAGCAAGCGGAAACCAAGCGCGGCAATGACGGCGTGCCCTGGGTGGGC
GGCAGCAATGCCGGTGGCGCGGGCCAGCCGGCCATCCGAGTGGTCGGCGATGTCACTCGGGCGGGCTACA
ACCTGGTCAATGGCCGCAGCGTGACCGACACGTCATCCATCGCCCAAGCGAGTTGCGCAAGCCTGTCCTG
CCAGACCTGGACCTCGCCGCAACAGGCGGTCGAATGGGCGACGCGGGTCCTGGGCGAGAAAGAGCAGCGC
ACCTGCGATGCCTGCACCAAGACCGAGACAGTGCCCGGTGTGGGGCTCACGCCGCTGATCCAGGAGGAGT
ACGAGGCGAAGTTGGAAGCCTTGCAGGAGCTGATCTCGGGGACGCGCAACACGACGTTCGAGAACCTGCG
CGTGGCTGGCAGCACCTCGCTGCCCATCACGCGCGGCGTCATCGAGGCGCTACGCGACGAGCCCGATCAA
GACCTGCTGGCGCGGCGACTGGCGTCCGAGGTGGCGCTGTCGTCCGTGCTGGAGAAAGCTCTGCTGCTCC
AGCGGACCCTGCTGACGGGCAAGAAGGAGCCCAACGTCGCCGCCAATGAACTCGCGGTGGAGGCCGTGAA
CCACGAGAGCGACACGCTCGACCGCGAGATCCAGAACCTGAAGACCGAGCTGGAACTGCGCCGCGAGCTG
GCCAACAACTCGCCGATGGCCATCATCCAGCGCCACGGCACGCGTGCGGCGGGTTCGCGTGGCATCTACG
AGGGTGATCCGGTGCCTGACCGTCTCGACCAGTTGCAGAAGGGCAATCCGGGAGTCCGGCCATGA
 Primer design