SecReT4
Protein ID: 189009172
T4SS name [ID]VirB [405]
Gene symbol-
Locus tagpMET1_009
StrainKlebsiella pneumoniae plasmid pMET-1 (NC_010726)
Repliconplasmid pMET-1 [GenBank: NC_010726] [Browse all T4SS(s) in this replicon]
Location [Strand]9443..9580 [+]
Producthypothetical protein
Component typeVirB7
UniProt IDB2CBD4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 45 a.a.     [Download]
>gi|189009172|ref|YP_001928054.1| hypothetical protein pMET1_009 [Klebsiella pneumoniae]
MKRLIALALLCALSGCAQNTPPSAFSGKGEPVNTPQIMAELNSHE
 
Nucleotide Sequence: 138 bp     [Download]
>gi|189009163|ref|NC_010726.1|:9443-9580 Klebsiella pneumoniae plasmid pMET-1, complete sequence
ATGAAACGCTTAATTGCGCTGGCTTTGCTGTGCGCACTTTCTGGCTGCGCCCAGAACACGCCTCCCTCTG
CCTTTAGCGGTAAGGGAGAACCCGTAAACACCCCTCAAATTATGGCGGAGTTAAACAGTCATGAGTGA
 Primer design