SecReT4
Protein ID: 189009173
T4SS name [ID]VirB [405]
Gene symbolvirB8
Locus tagpMET1_010
StrainKlebsiella pneumoniae plasmid pMET-1 (NC_010726)
Repliconplasmid pMET-1 [GenBank: NC_010726] [Browse all T4SS(s) in this replicon]
Location [Strand]9620..10255 [+]
ProductVirB8
Component typeVirB8
UniProt IDB2CBD5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.7e-49, Aligned region: 2..206
Protein Sequence: 211 a.a.     [Download]
>gi|189009173|ref|YP_001928055.1| VirB8 [Klebsiella pneumoniae]
MIERDKRATKAGFVVGGVGLLIAVLAIVAVVVMLPLKQTDVELYTVDNHTGRVEHVTRTSKTSLTATEAY
QKAMAANYVKVRERYVYPSLQDDYETVQVYNAPQVNDDYLALYAGKNAPDKVYKNGAHTVKVEILSNQIT
DATAPDRVATIRYKKIIRRLADNSTRNEYWDARFTFHSDPDKEMSDAEREINYFGFTVTSWQTDREIRGG
E
 
Nucleotide Sequence: 636 bp     [Download]
>gi|189009163|ref|NC_010726.1|:9620-10255 Klebsiella pneumoniae plasmid pMET-1, complete sequence
ATGATTGAGCGGGATAAACGCGCCACAAAAGCCGGTTTTGTGGTTGGCGGTGTGGGTCTGCTGATTGCGG
TGCTGGCGATCGTCGCCGTGGTCGTGATGTTGCCGCTGAAACAGACGGACGTTGAGCTGTATACCGTGGA
TAACCACACAGGACGGGTGGAACACGTTACCCGGACATCGAAAACCAGCCTGACCGCAACAGAAGCCTAT
CAAAAGGCGATGGCCGCAAACTACGTCAAAGTGCGTGAGCGGTATGTCTATCCCTCTTTGCAGGACGACT
ACGAGACGGTACAGGTCTACAACGCTCCCCAGGTAAACGATGACTATCTGGCGCTTTACGCCGGAAAAAA
CGCCCCGGACAAGGTTTATAAGAACGGGGCGCACACCGTGAAAGTGGAGATCCTGTCGAACCAGATCACC
GATGCGACTGCCCCTGATAGGGTCGCCACCATCCGCTACAAGAAGATTATCCGCCGTCTGGCTGATAACA
GCACCCGCAACGAGTATTGGGATGCCCGGTTCACGTTCCATTCTGACCCTGACAAGGAAATGAGCGATGC
GGAACGCGAGATCAACTACTTCGGCTTTACCGTCACCAGTTGGCAGACCGACCGCGAAATCCGGGGAGGT
GAATGA
 Primer design