SecReT4
Protein ID: 189009176
T4SS name [ID]VirB [405]
Gene symbolvirB11
Locus tagpMET1_013
StrainKlebsiella pneumoniae plasmid pMET-1 (NC_010726)
Repliconplasmid pMET-1 [GenBank: NC_010726] [Browse all T4SS(s) in this replicon]
Location [Strand]12465..13490 [+]
ProductVirB11
Component typeVirB11
UniProt IDB2CBD8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.3e-46, Aligned region: 18..279
Protein Sequence: 341 a.a.     [Download]
>gi|189009176|ref|YP_001928058.1| VirB11 [Klebsiella pneumoniae]
MTAKNISLDRYKQRFFGDFLELPGLTEIAVNRPGELYTKINGVWEQHAVPLSYEDCYNFARCLAKHHGDN
IEDIKPGLSATLESGERCQVIVPPACERDTVSITIRKPSKVQIPHQAYIDAGFYNRVTGEEKTETHDEEL
IAMYNTKNIPLFMEKCVEYGKTLAVAGETSTGKTTYMKMLIGYIPVHLRISTIEDNPEITFFIHKNYVHL
FYPSESSDEKGSIVTPASLLRWNYRMNPDRILLTEVRGAEAWDFLKITGSGHEGSMTSIHAGSAKEAIDG
FITRCYENPQCAQLPYTFMLRKVLDSLDVIVSIDLDGNVRRMNDIYFRPIHRNQYFEEMKA
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|189009163|ref|NC_010726.1|:12465-13490 Klebsiella pneumoniae plasmid pMET-1, complete sequence
ATGACCGCTAAGAATATTTCCCTCGACCGCTATAAACAGCGTTTCTTTGGCGACTTTCTGGAGCTTCCCG
GCCTGACGGAGATCGCCGTCAACCGTCCAGGTGAGCTGTATACCAAAATCAACGGCGTATGGGAGCAGCA
CGCCGTTCCTTTGTCCTATGAGGATTGCTACAACTTTGCCCGGTGCCTGGCAAAGCACCACGGCGACAAT
ATCGAAGATATTAAGCCGGGGCTGTCAGCCACGCTGGAATCCGGCGAACGGTGCCAGGTGATTGTTCCTC
CGGCTTGTGAGCGCGATACGGTGTCTATTACCATCCGTAAGCCATCAAAGGTACAAATCCCGCACCAGGC
GTATATTGATGCGGGATTTTATAACCGGGTAACAGGCGAGGAAAAAACGGAGACGCACGATGAGGAATTA
ATTGCAATGTACAATACAAAAAATATTCCTCTGTTTATGGAGAAATGCGTTGAGTACGGTAAAACCCTCG
CGGTCGCCGGGGAAACAAGCACCGGGAAAACCACCTATATGAAAATGTTGATAGGGTATATTCCTGTACA
TCTTCGGATATCAACCATTGAGGACAACCCGGAAATCACGTTCTTTATCCATAAAAACTACGTCCATCTT
TTTTATCCGTCAGAATCATCAGATGAAAAAGGTTCTATCGTTACCCCGGCGAGCCTTTTACGCTGGAATT
ACCGTATGAACCCTGACCGCATTTTATTAACAGAGGTTCGCGGTGCGGAAGCCTGGGACTTCCTTAAAAT
AACAGGTTCCGGCCATGAAGGGAGTATGACCTCCATTCATGCAGGATCTGCGAAAGAAGCTATAGACGGG
TTTATTACCCGTTGCTATGAAAATCCACAGTGTGCCCAACTCCCCTATACATTTATGTTACGTAAGGTTC
TGGATAGCCTGGACGTGATTGTGAGCATTGATTTAGACGGAAATGTTCGCCGTATGAATGACATCTATTT
CCGTCCAATTCATCGAAACCAGTATTTTGAGGAAATGAAAGCATGA
 Primer design