SecReT4
Protein ID: 189009180
T4SS name [ID]VirB [405]
Gene symbolmobB
Locus tagpMET1_017
StrainKlebsiella pneumoniae plasmid pMET-1 (NC_010726)
Repliconplasmid pMET-1 [GenBank: NC_010726] [Browse all T4SS(s) in this replicon]
Location [Strand]15331..17082 [+]
ProductMobB
Component typeVirD4
UniProt IDB2CBE2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 2e-12, Aligned region: 190..231
TrwB_AAD_bind [PF10412], Evalue: 2e-12, Aligned region: 351..542
T4SS-DNA_transf [PF02534], Evalue: 2.7e-12, Aligned region: 343..540
AAA_10 [PF12846], Evalue: 2.3e-09, Aligned region: 195..233
AAA_10 [PF12846], Evalue: 2.3e-09, Aligned region: 381..481
DUF87 [PF01935], Evalue: 8.2e-08, Aligned region: 179..233
TraG-D_C [PF12696], Evalue: 9.4e-08, Aligned region: 404..495
Protein Sequence: 583 a.a.     [Download]
>gi|189009180|ref|YP_001928062.1| MobB [Klebsiella pneumoniae]
MEKIDMGSHLMQRLNAFADAFSFFLLWLQNSPVILSLLAGLTLPFIFHLPREERKNAPFWLKSVACVSIF
FFIFGTISPLTIQGLSYFFKSLDNNILFRVPLWIMTIIFTAAGLIFHIAVRRLLAGEIDNLKHRMIKKSK
LERNTRTDVRKVKELLPDSIEYNPLDYIDLKKGVFIGLNKDDQPQYITIKEFKTQHAAIIGTTGSGKGVT
ATVLLYQAILLGEAVFVEDPKDDEWAPHVLREACKKAGKKFTLINLNKLNFQLDLLADISHEQLEELFNA
GFSLAKKGEASDFYRISDRRAARNTSAIYEKGMTLRDLFNTDFVQSLREDVPAFCGELEEIALVNSINAT
KGFSLKEVFDEGGCCYIIGSTRNQKIISAQRMILTRLIQIAETRDRINSTPRTVAIFLDELKYHLSRPAL
EGLGTARDKGVHIFMAFQAIDDLRDCPSDLNGDSVIGAIIENAKFKLIYKIQNPETAEWAAKMTGSILVD
DEMRKVRTDLSLTEKVDTDRMIRQAESYYVDSNMFLNLPEKVGFVFTSTELPRATKMFQVQVKKENIELL
SFEYKQATPEKNESQEHKPSINL
 
Nucleotide Sequence: 1752 bp     [Download]
>gi|189009163|ref|NC_010726.1|:15331-17082 Klebsiella pneumoniae plasmid pMET-1, complete sequence
ATGGAGAAAATAGATATGGGTTCCCACCTGATGCAAAGGCTGAATGCCTTTGCCGATGCATTTTCCTTTT
TTCTGTTATGGCTGCAAAACAGCCCTGTCATATTATCCCTGCTCGCAGGTCTTACATTACCTTTTATATT
CCACCTTCCCCGCGAGGAAAGAAAGAACGCCCCGTTCTGGTTAAAGTCGGTGGCGTGTGTGTCTATTTTC
TTTTTTATATTCGGCACCATATCACCGCTAACTATTCAGGGGTTGAGCTACTTTTTTAAGTCACTCGACA
ACAACATACTGTTTAGAGTTCCGCTATGGATCATGACCATAATATTTACGGCAGCAGGATTAATATTTCA
TATTGCAGTCCGACGACTTTTAGCAGGAGAAATTGACAACCTAAAACATCGAATGATTAAGAAAAGCAAG
CTGGAGAGAAATACCAGAACGGATGTACGCAAAGTAAAAGAGTTATTACCCGACAGCATAGAATACAATC
CACTCGATTACATTGATTTAAAGAAAGGCGTTTTTATTGGCTTAAACAAAGATGACCAGCCGCAATACAT
AACCATAAAAGAATTTAAAACCCAACACGCAGCAATTATTGGAACAACAGGTTCCGGAAAAGGCGTAACT
GCGACCGTCCTACTTTATCAGGCTATTCTTTTAGGTGAAGCTGTTTTTGTAGAAGATCCAAAAGATGATG
AATGGGCACCTCACGTACTTAGGGAAGCATGTAAAAAAGCAGGCAAGAAATTCACACTTATAAATTTAAA
TAAGCTAAATTTCCAGCTTGATTTACTGGCTGATATTTCTCATGAACAACTGGAGGAATTATTTAACGCT
GGCTTTAGCCTGGCTAAGAAAGGGGAGGCTTCAGATTTTTATCGTATTTCTGACCGTCGCGCAGCCAGAA
ATACATCTGCAATTTATGAAAAAGGAATGACACTTCGTGATTTATTTAACACTGATTTTGTTCAGTCATT
ACGTGAAGATGTTCCCGCATTTTGTGGCGAGCTGGAAGAAATTGCTTTAGTTAACTCAATTAATGCCACA
AAAGGATTTTCTTTAAAAGAGGTTTTTGATGAAGGTGGTTGTTGCTACATTATTGGTTCAACGCGCAATC
AAAAGATAATTTCCGCACAAAGAATGATTCTGACTCGGCTGATACAAATAGCAGAGACCAGGGACAGAAT
AAACAGCACTCCGCGTACTGTTGCTATTTTCCTCGACGAGTTGAAATATCATCTTTCTCGCCCTGCTCTT
GAAGGGCTTGGAACGGCACGAGATAAAGGCGTGCATATATTCATGGCTTTTCAGGCGATAGACGATCTGC
GTGACTGCCCGTCTGATTTAAATGGCGATTCAGTTATTGGCGCTATCATTGAAAACGCCAAATTCAAATT
AATTTATAAAATCCAAAACCCCGAAACAGCAGAATGGGCGGCAAAAATGACAGGCTCTATCCTGGTCGAT
GATGAAATGAGGAAAGTACGGACTGATTTGTCATTGACGGAAAAAGTGGACACAGACCGAATGATAAGAC
AGGCAGAAAGTTACTACGTTGACAGTAATATGTTTTTAAATCTCCCTGAAAAAGTTGGTTTTGTATTTAC
GTCAACCGAACTACCTAGAGCTACAAAGATGTTTCAGGTTCAGGTCAAAAAAGAAAATATCGAACTTCTT
TCATTTGAGTATAAACAAGCCACACCAGAAAAAAATGAAAGTCAGGAACATAAGCCATCAATCAATCTGT
GA
 Primer design