SecReT4
Protein ID: 189009840
T4SS name [ID]Trw [135]
Gene symboltrwE
Locus tagpIncW_014
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid IncW pIE321 (NC_010716)
Repliconplasmid IncW pIE321 [GenBank: NC_010716] [Browse all T4SS(s) in this replicon]
Location [Strand]14287..15474 [-]
ProductTrwE
Component typeTrwE
UniProt IDA7KZU7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.2e-63, Aligned region: 205..383
Protein Sequence: 395 a.a.     [Download]
>gi|189009840|ref|YP_001911168.1| TrwE [Salmonella enterica subsp. enterica serovar Dublin]
MFGRKKGDVIDAGAELERAEQERIEGEYGASELASERRPHTPGARTLLMVLLCVIAVVLVTLSYKAYKVR
GVVEDDDAQPQQVVHQVIPGYTPRPIRPEPENVPEPPQPTTSVPAIQPAPVTQPVRPQPTGPREKTPYEL
ARERMLRSGLTAGSGGGDDLPRPQGGDVPAGGLMGGGGGGGELAEKLQPMRLSGSSAGRLGNRDMLITQG
TQLDCVLETRLVTTQPGMTTCHLTRDVYSTSGRVVLLDRGSKVVGFYQGGLRQGQARIFVQWSRIETPSG
VVINLDSPGTGPLGEAGLGGWIDRHFWERFGGAIMISLIGDLGDWASRQGSRQGNNSIQFSNTANGVESA
AAEALRNSINIPPTLYKNQGERVNILVARDLDFSDVYSLESIPTK
 
Nucleotide Sequence: 1188 bp     [Download]
>gi|189009811|ref|NC_010716.1|:c15474-14287 Salmonella enterica subsp. enterica serovar Dublin plasmid IncW pIE321, complete sequence
ATGTTCGGTCGCAAGAAAGGAGACGTAATCGACGCGGGCGCGGAACTGGAACGCGCCGAGCAGGAACGTA
TCGAGGGCGAATATGGCGCTTCCGAGCTGGCTTCGGAACGTCGCCCGCATACTCCCGGTGCTCGCACACT
GCTTATGGTGCTGCTGTGCGTGATTGCCGTGGTGCTGGTGACGCTCTCATACAAGGCGTACAAAGTGCGC
GGGGTTGTCGAGGATGACGACGCGCAGCCGCAACAGGTCGTGCACCAAGTCATTCCGGGTTATACGCCGC
GTCCAATCCGACCCGAGCCGGAAAACGTACCTGAACCGCCGCAACCGACTACATCGGTTCCAGCGATTCA
GCCCGCGCCGGTAACGCAGCCAGTGCGCCCGCAACCGACCGGCCCGCGTGAAAAAACGCCCTATGAGCTG
GCCCGCGAACGCATGTTGCGCTCTGGCCTGACGGCGGGCAGCGGTGGCGGTGATGATCTTCCTCGGCCGC
AAGGCGGCGATGTGCCTGCCGGTGGCCTGATGGGTGGCGGTGGTGGCGGCGGTGAGCTGGCCGAAAAGCT
GCAACCGATGCGCCTTTCGGGTTCAAGTGCTGGCCGCCTTGGCAACCGTGACATGCTGATAACGCAGGGA
ACGCAGCTCGATTGCGTGCTTGAAACGCGCCTTGTGACGACGCAACCCGGCATGACTACCTGCCATCTGA
CGCGGGACGTTTACTCGACCAGTGGCCGCGTAGTGCTGCTTGATCGTGGCTCTAAAGTCGTCGGGTTCTA
TCAAGGCGGGCTGCGGCAAGGCCAAGCGCGAATCTTCGTGCAGTGGTCGCGGATTGAAACGCCCTCCGGT
GTCGTCATCAACCTAGATTCTCCCGGTACTGGCCCGCTTGGCGAAGCTGGTTTGGGTGGCTGGATTGATC
GGCATTTTTGGGAGCGTTTCGGCGGTGCCATCATGATTAGCTTGATTGGTGATTTGGGCGATTGGGCAAG
CCGTCAAGGCAGTCGCCAAGGCAATAACTCTATCCAGTTTTCCAACACTGCGAACGGGGTGGAATCGGCT
GCTGCGGAAGCTCTGCGCAACTCGATCAACATTCCGCCCACTCTGTATAAAAACCAAGGCGAGCGGGTGA
ATATCCTCGTCGCCCGTGATCTGGATTTCAGCGATGTCTACAGTCTCGAAAGCATCCCCACTAAGTAG
 Primer design