SecReT4
Protein ID: 189009841
T4SS name [ID]Trw [135]
Gene symboltrwF
Locus tagpIncW_015
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid IncW pIE321 (NC_010716)
Repliconplasmid IncW pIE321 [GenBank: NC_010716] [Browse all T4SS(s) in this replicon]
Location [Strand]15474..16274 [-]
ProductTrwF
Component typeTrwF
UniProt IDA7KZU8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.8e-64, Aligned region: 30..240
Protein Sequence: 266 a.a.     [Download]
>gi|189009841|ref|YP_001911169.1| TrwF [Salmonella enterica subsp. enterica serovar Dublin]
MKKLAIVALLASLHAVPALALDVPTSSRYDHRIRYVTYNPADVVQVDTVLGVATHIMLEEGEQYLTHAFG
DSEAYAFARKGRHIFIKPQAELANTNLIVVTDRRSYKFRLQMRNDRNGAMYELAFRYPDTQARQTREANA
RAAVEAAFEQRVGAYYNLKYMMSGDKDIAPVNAWDDGRFTYFKFSANADLPSIYFVDAEGNESLVPRTTV
GSSNNIIAVHKVNPKWMIRLGNRALAIFNEAYDPNGVPNDTGTASPAVRRVNKGGN
 
Nucleotide Sequence: 801 bp     [Download]
>gi|189009811|ref|NC_010716.1|:c16274-15474 Salmonella enterica subsp. enterica serovar Dublin plasmid IncW pIE321, complete sequence
ATGAAGAAACTAGCTATCGTTGCATTGCTGGCCTCGCTTCATGCGGTGCCCGCTTTGGCCCTCGATGTGC
CGACCAGCTCGCGTTACGACCATCGGATTCGATACGTGACGTACAACCCGGCTGATGTGGTGCAGGTCGA
TACCGTTCTTGGTGTCGCAACACACATCATGCTTGAGGAAGGTGAGCAATATCTGACGCATGCCTTTGGC
GATTCCGAAGCCTATGCCTTTGCCCGGAAGGGGCGGCATATTTTTATCAAGCCGCAGGCCGAGCTAGCCA
ATACCAACCTCATCGTCGTGACTGACCGACGCAGCTACAAATTCCGTTTGCAAATGCGGAATGACCGCAA
TGGGGCCATGTATGAGCTGGCTTTCCGTTATCCCGATACGCAGGCCCGGCAAACTCGGGAAGCGAACGCA
CGGGCCGCTGTCGAGGCTGCATTCGAGCAACGTGTAGGGGCCTATTACAACCTCAAATACATGATGAGCG
GCGACAAGGACATTGCGCCGGTCAACGCTTGGGATGATGGGCGTTTCACCTACTTCAAGTTCTCTGCCAA
CGCAGATTTGCCGTCGATCTACTTTGTGGATGCGGAAGGCAATGAAAGCCTTGTGCCGCGCACTACGGTT
GGCTCGTCCAACAACATCATTGCCGTTCACAAGGTCAATCCCAAGTGGATGATTCGACTTGGTAACCGCG
CCTTGGCGATCTTCAATGAAGCGTATGACCCCAATGGTGTGCCGAATGACACTGGCACAGCCTCCCCGGC
GGTTCGTCGCGTCAACAAAGGAGGCAACTAA
 Primer design