SecReT4
Protein ID: 189009842
T4SS name [ID]Trw [135]
Gene symboltrwG
Locus tagpIncW_016
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid IncW pIE321 (NC_010716)
Repliconplasmid IncW pIE321 [GenBank: NC_010716] [Browse all T4SS(s) in this replicon]
Location [Strand]16286..16981 [-]
ProductTrwG
Component typeTrwG
UniProt IDA7KZU9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9.4e-59, Aligned region: 21..227
Protein Sequence: 231 a.a.     [Download]
>gi|189009842|ref|YP_001911170.1| TrwG [Salmonella enterica subsp. enterica serovar Dublin]
MSKKQPKPVKAEQLKSYYEESRGLERDLIGEFVKSRKTAWRVATASGLFGLLGMVCGIVGFSQPAPAPLV
LRVDNATGAVDVVTTLREHESSYGEVVDTYWLNQYVLNREAYDYNTIQMNYDTTALLSAPAVQQEYYKLF
DGSNARDRVLGNKARITVRVRSIQPNGRGQATVRFTTQQHNSNGTVEAPQHQIATIGYTYIGAPMRSSDR
LLNPLGFQVTSYRADPEILNN
 
Nucleotide Sequence: 696 bp     [Download]
>gi|189009811|ref|NC_010716.1|:c16981-16286 Salmonella enterica subsp. enterica serovar Dublin plasmid IncW pIE321, complete sequence
ATGAGCAAGAAGCAACCAAAACCGGTCAAGGCAGAACAGCTCAAAAGCTACTATGAGGAAAGCCGTGGCT
TGGAACGGGATTTGATTGGCGAGTTCGTCAAATCGCGCAAGACCGCTTGGCGGGTGGCAACGGCGAGCGG
CCTTTTCGGCCTGCTTGGCATGGTCTGCGGAATTGTCGGGTTCTCCCAACCGGCTCCCGCGCCCTTGGTG
CTTCGGGTGGATAACGCCACGGGTGCCGTCGATGTGGTGACGACGCTGCGCGAGCATGAGTCCAGCTATG
GCGAAGTGGTCGATACGTACTGGCTCAATCAGTACGTACTCAATCGCGAAGCCTACGACTACAACACAAT
CCAAATGAACTATGACACGACGGCGCTATTGAGCGCCCCGGCGGTTCAGCAGGAATACTACAAGCTCTTT
GACGGCTCGAATGCGCGTGATCGGGTCTTGGGGAACAAAGCCCGCATTACCGTTCGGGTGCGCTCCATCC
AACCTAATGGCCGCGGCCAAGCGACGGTGCGCTTTACGACGCAACAACACAACAGCAATGGCACGGTCGA
AGCTCCGCAACATCAGATAGCGACGATTGGCTATACCTACATCGGTGCGCCGATGCGTTCATCTGATCGG
TTGCTTAACCCTCTTGGTTTCCAGGTCACAAGCTATCGCGCTGACCCGGAAATACTCAATAACTGA
 Primer design