SecReT4
Protein ID: 189009843
T4SS name [ID]Trw [135]
Gene symboltrwH
Locus tagpIncW_017
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid IncW pIE321 (NC_010716)
Repliconplasmid IncW pIE321 [GenBank: NC_010716] [Browse all T4SS(s) in this replicon]
Location [Strand]16978..17121 [-]
ProductTrwH
Component typeTrwH
UniProt IDA7KZV0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 47 a.a.     [Download]
>gi|189009843|ref|YP_001911171.1| TrwH [Salmonella enterica subsp. enterica serovar Dublin]
MKTIIFAILMTGLLSACASAPKPKQPSDFNREPVNKTVPVEIQRGAL
 
Nucleotide Sequence: 144 bp     [Download]
>gi|189009811|ref|NC_010716.1|:c17121-16978 Salmonella enterica subsp. enterica serovar Dublin plasmid IncW pIE321, complete sequence
GTGAAAACCATCATTTTTGCAATTTTGATGACGGGGCTATTGTCGGCGTGTGCATCGGCTCCCAAGCCGA
AGCAGCCGAGTGATTTCAACCGGGAGCCGGTAAACAAGACGGTGCCCGTGGAAATTCAGCGAGGGGCACT
ATGA
 Primer design