SecReT4
Protein ID: 189009846
T4SS name [ID]Trw [135]
Gene symboltrwJ
Locus tagpIncW_020
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid IncW pIE321 (NC_010716)
Repliconplasmid IncW pIE321 [GenBank: NC_010716] [Browse all T4SS(s) in this replicon]
Location [Strand]18502..19191 [-]
ProductTrwJ
Component typeTrwJ
UniProt IDA7KZV3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 3.8e-59, Aligned region: 24..212
OmpH [PF03938], Evalue: 4.6e-05, Aligned region: 9..207
Protein Sequence: 229 a.a.     [Download]
>gi|189009846|ref|YP_001911174.1| TrwJ [Salmonella enterica subsp. enterica serovar Dublin]
MKKLVMTAAVAAILGAASPVMAQGIPVFDATRALDFVQQFARMKEQLDTAKDQLAEAQRMYEAVTGDRGL
GDLMRNAQLREYLPDDLRTVYDSANGGGYAGISGSINDILRDERLNGSVADMRRSIEERSRTAAATDKAV
GLRAYEGAQQRLAQIEGLMDEISRTQDQKAIEELQARIAGEQAAIQNETTKLQMIAHLRQAEQSLISEQR
RERNMRILSSGNQGMPTIQ
 
Nucleotide Sequence: 690 bp     [Download]
>gi|189009811|ref|NC_010716.1|:c19191-18502 Salmonella enterica subsp. enterica serovar Dublin plasmid IncW pIE321, complete sequence
ATGAAAAAGCTGGTTATGACGGCGGCGGTTGCCGCCATTCTCGGGGCGGCCAGCCCTGTAATGGCCCAGG
GCATTCCTGTTTTCGACGCCACGCGGGCACTGGATTTTGTCCAACAGTTTGCCCGCATGAAAGAACAGCT
CGACACGGCCAAAGATCAGCTCGCGGAAGCGCAGCGCATGTATGAGGCTGTCACGGGCGACCGTGGCCTT
GGGGATTTGATGCGTAATGCGCAGCTCCGCGAATATCTGCCGGATGATTTGCGCACGGTCTATGACTCGG
CCAACGGTGGCGGCTATGCGGGCATTTCTGGCTCGATCAATGACATTCTGCGGGATGAGCGCCTTAACGG
CTCTGTGGCCGATATGCGGCGCTCTATCGAGGAACGCAGTCGCACGGCGGCGGCAACCGACAAGGCCGTT
GGCCTGCGGGCCTATGAAGGCGCACAGCAACGCCTCGCGCAGATTGAAGGGCTGATGGATGAAATCAGCC
GTACCCAAGACCAAAAGGCCATTGAAGAATTGCAAGCCCGCATCGCGGGCGAGCAAGCCGCTATCCAGAA
CGAAACGACGAAGCTCCAAATGATCGCGCATCTGCGGCAAGCAGAACAGTCGCTTATTTCGGAACAACGC
CGCGAGCGCAACATGCGCATCCTGAGTAGCGGGAACCAAGGAATGCCAACTATCCAATGA
 Primer design