SecReT4
Protein ID: 189009849
T4SS name [ID]Trw [135]
Gene symboltrwL
Locus tagpIncW_023
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid IncW pIE321 (NC_010716)
Repliconplasmid IncW pIE321 [GenBank: NC_010716] [Browse all T4SS(s) in this replicon]
Location [Strand]21989..22327 [-]
ProductTrwL
Component typeTrwL
UniProt IDA7KZV6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.8e-18, Aligned region: 17..110
Protein Sequence: 112 a.a.     [Download]
>gi|189009849|ref|YP_001911177.1| TrwL [Salmonella enterica subsp. enterica serovar Dublin]
MATSILTRKTNMKKLNYLRAKANGKLAAIFGAMAAMLTAQPAAAQGLEKARGVLETLQQELTTIVPIAAA
VILLCLGIAYAGRFIEKDTFVRWSIGVIIAGSAVQITAMLFT
 
Nucleotide Sequence: 339 bp     [Download]
>gi|189009811|ref|NC_010716.1|:c22327-21989 Salmonella enterica subsp. enterica serovar Dublin plasmid IncW pIE321, complete sequence
ATGGCAACTTCAATCTTGACGAGGAAAACAAACATGAAGAAGCTGAACTACCTCCGGGCGAAAGCTAACG
GAAAGCTGGCCGCGATTTTTGGAGCAATGGCGGCCATGCTCACTGCTCAACCGGCGGCGGCTCAAGGATT
GGAAAAGGCGAGGGGCGTCCTCGAAACATTGCAGCAGGAACTTACGACGATTGTGCCCATTGCGGCCGCT
GTCATCCTGCTCTGCCTCGGCATCGCATACGCGGGCCGATTCATCGAAAAGGATACGTTTGTGCGGTGGT
CTATCGGCGTCATCATTGCCGGTTCCGCCGTCCAGATTACGGCCATGCTGTTTACCTAA
 Primer design