SecReT4
Protein ID: 189009851
T4SS name [ID]Trw [135]
Gene symbol-
Locus tagpIncW_025
StrainSalmonella enterica subsp. enterica serovar Dublin plasmid IncW pIE321 (NC_010716)
Repliconplasmid IncW pIE321 [GenBank: NC_010716] [Browse all T4SS(s) in this replicon]
Location [Strand]22678..23376 [-]
ProductTrwN
Component typeTrwN
UniProt IDA7KZV8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 3.4e-22, Aligned region: 7..148
Protein Sequence: 232 a.a.     [Download]
>gi|189009851|ref|YP_001911179.1| TrwN [Salmonella enterica subsp. enterica serovar Dublin]
MALAEFAVIAAMCAPAIHPTTLSAVVTQESRGNIYAIGINGDHKLPRQPQTLEEAIATAEQLRRDGYNFD
AGLGQINIKNLEWLGMSIADLFDPCKNLKGAQTVLLDCYERAVPRYGDGQGALQAALSCYNTGNFQRGFS
NGYVQKVASHVGVTVPALEPVSGGTQEPAKLQAVPKGAARLAPAQTKPREGLADAFSHEASGVRDAFNAS
DAFSENEEEEKEVKATAAVDQN
 
Nucleotide Sequence: 699 bp     [Download]
>gi|189009811|ref|NC_010716.1|:c23376-22678 Salmonella enterica subsp. enterica serovar Dublin plasmid IncW pIE321, complete sequence
ATGGCACTGGCAGAGTTCGCGGTGATCGCTGCCATGTGCGCGCCCGCTATCCATCCGACAACGCTTTCGG
CGGTTGTGACGCAAGAATCTCGGGGCAATATCTACGCCATCGGGATTAACGGTGATCACAAATTGCCGCG
TCAGCCGCAAACGCTTGAAGAAGCCATTGCGACCGCCGAACAGCTCCGCCGTGATGGGTACAACTTCGAT
GCGGGCCTCGGTCAGATCAACATCAAAAATCTGGAATGGCTCGGCATGTCTATCGCCGACCTGTTCGACC
CGTGCAAGAACCTGAAAGGGGCGCAAACCGTATTGCTCGACTGCTACGAAAGGGCAGTGCCGCGATATGG
CGACGGCCAGGGCGCATTGCAGGCGGCTTTGAGCTGCTACAACACGGGCAATTTCCAGCGCGGATTCTCC
AATGGCTATGTGCAGAAAGTGGCTTCTCATGTTGGCGTAACGGTACCTGCGCTTGAGCCGGTATCTGGTG
GGACACAAGAACCGGCCAAGCTGCAAGCGGTGCCCAAGGGCGCGGCGCGTTTAGCTCCGGCACAAACGAA
GCCACGGGAAGGGCTTGCAGATGCCTTCTCTCATGAGGCGAGCGGTGTACGTGACGCATTTAATGCAAGC
GATGCCTTTTCGGAGAATGAAGAAGAAGAAAAGGAGGTGAAGGCAACTGCCGCCGTTGATCAAAATTGA
 Primer design