SecReT4
Protein ID: 189017133
T4SS name [ID]VirB [784]
Gene symboltraG
Locus tagETA_pET490120
StrainErwinia tasmaniensis Et1/99
Repliconplasmid pET49 [GenBank: NC_010697] [Browse all T4SS(s) in this replicon]
Location [Strand]8221..8952 [+]
ProductTraG protein
Component typeVirB8
UniProt IDB2VAV1
KEGG IDeta:ETA_pET490120
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1e-61, Aligned region: 31..240
Protein Sequence: 243 a.a.     [Download]
>gi|189017133|ref|YP_001909450.1| TraG protein [Erwinia tasmaniensis Et1/99]
MMLSYFQRTKKEAEKTKVESKKEMDNYFAAIRDFERDRISLINGKVKFFQIGAFLCMIVIVIQAVALALM
SPLKTAVPVMIRVDNNTGYTDAVSPLSDAKESYDEVVNKYFLSQYVVNYESYDWQTIQSMNDTVDLMSDS
KTFSQYKTQITADNSPLNVLKQNNKIKVRVKSVTFLKDDIAQIRFDKAVLNTDGTLSADYSQTSWVATLA
FDYKRKIKSEGERLLNPLGFQALSYRVDPEAIK
 
Nucleotide Sequence: 732 bp     [Download]
>gi|189017121|ref|NC_010697.1|:8221-8952 Erwinia tasmaniensis Et1/99 plasmid pET49, complete sequence
ATGATGTTAAGTTATTTCCAAAGAACTAAAAAAGAGGCAGAGAAAACAAAAGTTGAATCAAAAAAGGAGA
TGGATAACTACTTCGCTGCAATAAGGGATTTTGAACGTGACCGTATTTCTTTGATTAATGGAAAGGTGAA
GTTTTTTCAGATCGGCGCTTTTCTTTGTATGATTGTTATTGTGATACAAGCGGTTGCATTAGCTTTAATG
TCACCTTTGAAAACTGCTGTTCCTGTTATGATTCGTGTTGATAACAATACTGGATATACAGATGCAGTTT
CGCCACTGAGCGATGCAAAAGAATCTTATGATGAGGTGGTGAATAAATATTTCCTCTCTCAATACGTCGT
CAATTATGAAAGTTATGATTGGCAAACCATTCAATCTATGAATGACACAGTAGATCTGATGTCAGACAGT
AAAACGTTTTCTCAGTACAAGACACAAATTACAGCAGATAACTCTCCTTTGAATGTGTTGAAACAAAACA
ACAAAATTAAGGTTCGTGTTAAGTCTGTTACTTTTTTAAAGGATGACATTGCACAGATTCGCTTTGATAA
AGCCGTTCTTAACACTGATGGTACTTTGTCAGCTGATTACAGCCAAACATCCTGGGTAGCAACCCTTGCA
TTCGATTACAAACGTAAAATAAAGAGCGAAGGGGAGCGCTTGCTAAATCCCCTCGGTTTTCAGGCTTTGA
GCTACAGAGTCGATCCGGAGGCTATAAAATAA
 Primer design