SecReT4
Protein ID: 189017136
T4SS name [ID]VirB [784]
Gene symboltraJ
Locus tagETA_pET490150
StrainErwinia tasmaniensis Et1/99
Repliconplasmid pET49 [GenBank: NC_010697] [Browse all T4SS(s) in this replicon]
Location [Strand]10855..11874 [+]
ProductTraJ protein
Component typeVirB11
UniProt IDB2VAV4
KEGG IDeta:ETA_pET490150
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4e-63, Aligned region: 17..315
Protein Sequence: 339 a.a.     [Download]
>gi|189017136|ref|YP_001909453.1| TraJ protein [Erwinia tasmaniensis Et1/99]
MIEDNSDIARLYLEKTGIQALLNREGLTEVAINQPGRIWYEGREGWQFVEEPAANFENLKHLAESLSTYS
NLPQLNQSNPIASVILPDGERGQIIMPPATEPGCIAISIRKPSLQRFSIADYVNSGRFDNVRIAQKQTVE
LSDKQKKLYELYQKGDPKSLEKFIYEAVRERLNFLIVGGTGSGKTTIAKAVADIFPPERRYATIEDVPEM
QLPNHPNHIHLFYKKGVITAKTIIEACMRLKPDHIFLAELRGDEAWSYLEALNTGHEGSISTIHANSTYA
SFSRLASIVKQSCVGMTVDMELIMRTIKTSVDVILFFNHTHMTEIYFEPQEKNKLLNKM
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|189017121|ref|NC_010697.1|:10855-11874 Erwinia tasmaniensis Et1/99 plasmid pET49, complete sequence
TTGATTGAAGATAATTCTGATATAGCGCGCCTTTATCTGGAAAAGACAGGTATTCAAGCGCTGTTGAACC
GAGAGGGGCTAACAGAGGTTGCTATCAATCAACCTGGCAGGATTTGGTATGAGGGCCGTGAAGGATGGCA
GTTTGTTGAGGAACCGGCAGCGAATTTTGAAAACCTGAAGCACCTTGCAGAAAGTCTGTCCACTTACTCT
AACCTTCCTCAGTTAAACCAGTCTAATCCCATTGCTTCTGTGATCCTTCCCGATGGTGAAAGGGGCCAAA
TTATTATGCCGCCAGCCACGGAACCCGGCTGTATTGCGATTTCAATACGTAAACCATCTCTTCAGCGTTT
TTCTATTGCAGACTATGTTAACTCTGGTCGATTTGACAATGTACGAATCGCACAAAAGCAAACGGTAGAA
CTTTCGGACAAGCAGAAAAAATTGTATGAACTCTATCAAAAAGGTGACCCAAAAAGTCTTGAAAAATTCA
TTTATGAGGCGGTTAGAGAAAGACTTAATTTCCTGATTGTCGGTGGTACAGGATCAGGTAAGACAACAAT
AGCAAAAGCCGTTGCTGATATATTTCCTCCAGAAAGGCGATATGCAACCATCGAGGATGTTCCTGAAATG
CAATTGCCTAATCACCCCAATCACATTCATCTGTTTTATAAAAAGGGAGTTATTACCGCTAAAACAATAA
TTGAAGCATGTATGCGCCTGAAGCCAGATCATATTTTCCTGGCTGAACTTCGCGGTGATGAAGCCTGGAG
TTACTTAGAAGCATTAAACACAGGTCATGAAGGGTCTATCTCAACCATTCATGCGAACAGTACCTATGCT
TCATTCTCACGCCTGGCAAGTATAGTTAAGCAGTCATGCGTGGGTATGACTGTTGATATGGAACTGATTA
TGCGAACTATCAAAACATCGGTTGACGTGATTTTGTTTTTTAATCATACGCATATGACGGAAATCTATTT
TGAGCCTCAAGAGAAAAATAAATTATTGAATAAGATGTAA
 Primer design