SecReT4
Protein ID: 189017137
T4SS name [ID]VirB [784]
Gene symboltraK
Locus tagETA_pET490160
StrainErwinia tasmaniensis Et1/99
Repliconplasmid pET49 [GenBank: NC_010697] [Browse all T4SS(s) in this replicon]
Location [Strand]11900..13696 [+]
ProductTraK protein
Component typeVirD4
UniProt IDB2VAV5
KEGG IDeta:ETA_pET490160
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.4e-90, Aligned region: 127..582
TraG-D_C [PF12696], Evalue: 1.1e-22, Aligned region: 417..541
TrwB_AAD_bind [PF10412], Evalue: 1.2e-19, Aligned region: 220..544
Protein Sequence: 598 a.a.     [Download]
>gi|189017137|ref|YP_001909454.1| TraK protein [Erwinia tasmaniensis Et1/99]
MSKIIGVSSILLLMFLASVVGGNYLGGYAALKYSGLNIDSLSANTFYEVISNYGGNPSYKSLVGITWFGF
GVPVVVFVAFCVLILFNLNPDKVIYGNSRLATDMDLAKSGFFPTLKQSKKHKYPPILIGKMNKGRFKGQY
IYYYGQQFLMLYAPTRSGKGVGIVIPNCLNYPESLVVLDIKLENWFLSSGYRKKVMGQECYLFCPAGYVE
NEERAKAGEYRSHRWNPMDYVSRDALQRQTDLRKIASVLYPLSGGDNDVWNTSAINLFIGLALYLIDKEH
EAQENLTVSIAKVLKSATPGGDLAAWMRKTLAKDAAVSTEARDYFEIFMAAPDKTRGSIMSNFTNGLDIF
ANPVTAAATSASDFNIRRLRKDKMSVYLGLTPDSLVTHKKLVNLFFSMIVNENTKELPEQNPELKYQVVL
LEDEFTSMGRVEIIQKSIAYTAGFNLRYVFILQNKGQMEDEKLYGKEGTETFIKNCAVEIVYPPRDVDDA
VKEISERIGVFDKKIKRKSKSDNRGSAGGSKSVADDVISSPVLLPDDIVALGKVKNKSETMKIREIILSE
ACYPFIADKIVYFEDPVFMGRVKIAKENHIEIPLLFNS
 
Nucleotide Sequence: 1797 bp     [Download]
>gi|189017121|ref|NC_010697.1|:11900-13696 Erwinia tasmaniensis Et1/99 plasmid pET49, complete sequence
ATGAGTAAGATAATTGGCGTATCATCAATACTTTTATTAATGTTTCTTGCTTCGGTTGTTGGTGGTAATT
ATTTAGGTGGTTATGCAGCGTTAAAATATTCAGGCTTAAATATTGATTCACTTAGCGCGAATACATTTTA
TGAAGTAATAAGTAATTACGGTGGTAATCCGTCCTATAAATCGCTGGTTGGTATCACATGGTTTGGGTTT
GGTGTTCCAGTCGTCGTGTTTGTGGCTTTCTGTGTTCTGATATTGTTTAACCTTAATCCAGATAAGGTTA
TCTATGGTAATTCCCGCCTCGCTACCGATATGGATTTAGCAAAGTCGGGTTTTTTCCCAACCCTGAAGCA
ATCTAAGAAACATAAATACCCGCCTATTCTTATAGGGAAAATGAATAAAGGCAGATTTAAAGGGCAGTAC
ATTTATTACTATGGTCAGCAGTTTTTAATGCTTTATGCCCCAACACGATCCGGTAAAGGGGTCGGTATTG
TTATCCCTAATTGCCTCAACTATCCTGAAAGCCTGGTTGTCCTCGATATTAAACTGGAAAACTGGTTCCT
GTCGTCAGGCTACCGTAAGAAAGTAATGGGCCAGGAGTGCTATCTGTTTTGTCCCGCTGGGTATGTGGAG
AATGAGGAAAGGGCTAAGGCAGGGGAGTACCGTTCTCATCGTTGGAATCCGATGGATTACGTTAGCCGCG
ACGCGCTACAGCGTCAGACGGACTTACGTAAGATTGCATCCGTTCTGTATCCTCTGAGCGGCGGTGATAA
CGATGTGTGGAACACGTCAGCTATAAACTTGTTTATAGGTCTTGCACTATATCTTATCGATAAAGAGCAT
GAAGCGCAGGAGAACCTGACAGTTTCCATTGCTAAGGTTTTGAAGTCTGCAACGCCTGGCGGCGATCTTG
CTGCCTGGATGCGCAAGACTCTCGCAAAGGATGCTGCTGTTAGCACAGAGGCCCGGGATTATTTTGAAAT
CTTTATGGCTGCACCTGATAAAACGCGTGGCAGTATTATGAGTAATTTTACCAATGGTCTTGATATTTTC
GCTAACCCTGTAACGGCTGCGGCGACAAGCGCCAGTGATTTTAATATTCGTCGTTTAAGAAAAGATAAAA
TGTCTGTTTATCTTGGTCTTACGCCGGACAGCCTTGTAACCCACAAAAAGCTGGTCAATCTTTTCTTCTC
CATGATTGTTAACGAAAACACAAAAGAACTGCCTGAGCAAAACCCGGAGTTAAAATATCAGGTTGTGCTA
TTAGAGGATGAGTTTACGAGCATGGGGCGAGTGGAGATCATTCAAAAGTCCATTGCTTACACTGCTGGTT
TTAATCTGCGTTATGTTTTCATTTTGCAGAATAAAGGGCAGATGGAAGATGAGAAGCTTTATGGGAAAGA
GGGTACTGAAACTTTTATTAAAAACTGCGCAGTAGAAATTGTTTATCCTCCGCGTGACGTTGATGATGCG
GTAAAAGAAATATCAGAACGCATTGGTGTATTTGATAAAAAAATCAAGCGAAAATCCAAATCTGATAACC
GGGGGAGCGCAGGCGGTTCTAAGTCTGTAGCTGATGATGTTATATCCAGCCCTGTATTACTTCCAGATGA
TATTGTTGCGCTTGGTAAGGTAAAAAACAAAAGCGAGACAATGAAAATTAGGGAGATCATATTAAGCGAG
GCTTGCTATCCATTTATCGCTGATAAGATTGTCTATTTCGAAGATCCCGTTTTTATGGGGCGTGTGAAAA
TAGCTAAGGAAAATCACATAGAAATACCTCTACTTTTCAATTCATAA
 Primer design