SecReT4
Protein ID: 189022285
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_II00530
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010740] [Browse all T4SS(s) in this replicon]
Location [Strand]56646..57731 [-]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDB2SCM6
KEGG IDbmc:BAbS19_II00530
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.4e-66, Aligned region: 25..327
Protein Sequence: 361 a.a.     [Download]
>gi|189022285|ref|YP_001932026.1| type IV secretion system protein VirB11 [Brucella abortus S19]
MSNRSDFIVPDEAAVKRAASVNFHLEPLRPWLDDPQITEVCVNRPGEVFCERASAWEYYAVPNLDYEHLI
SLGTATARFVDQDISDSRPVLSAILPMGERIQIVRPPACEHGTISVTIRKPSFTRRTLEDYAQQGFFKHV
RPMSKSLTPFEQELLALKEAGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQRLITIEDV
PELFLPDHPNHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGETYDFINVAASGHGGSI
TSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHDGTGRHISEVWYDPNTKR
ALSLQHSEKTQ
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|189022234|ref|NC_010740.1|:c57731-56646 Brucella abortus S19 chromosome 2, complete sequence
ATGTCAAACCGAAGTGACTTTATTGTGCCTGACGAGGCGGCTGTCAAACGGGCGGCCTCGGTCAATTTCC
ATCTGGAACCGCTACGCCCTTGGTTGGACGATCCGCAGATCACCGAAGTTTGCGTGAACCGGCCGGGCGA
AGTGTTCTGCGAGCGAGCAAGCGCGTGGGAATACTATGCGGTGCCAAACCTCGACTATGAACACCTGATT
TCGCTGGGAACCGCCACCGCGCGGTTTGTGGATCAGGATATTTCGGACAGCCGACCGGTGCTGTCTGCGA
TCCTGCCGATGGGTGAGCGCATTCAGATTGTGCGCCCGCCCGCATGTGAGCACGGCACCATCTCGGTGAC
GATCCGCAAGCCGTCTTTCACCCGGCGCACACTGGAAGACTATGCGCAGCAGGGCTTTTTCAAACACGTC
AGACCCATGAGTAAGAGCCTGACGCCGTTTGAACAGGAACTGCTCGCATTGAAGGAAGCTGGTGATTACA
TGAGCTTCCTGCGGCGGGCGGTACAGCTTGAAAGGGTGATCGTCGTCGCCGGCGAGACGGGATCAGGCAA
GACCACACTGATGAAAGCGCTGATGCAGGAAATTCCGTTCGATCAGCGCCTGATCACCATCGAGGACGTA
CCGGAGTTGTTCTTGCCGGACCATCCGAACCACGTCCACCTGTTTTATCCGAGCGAAGCGAAGGAAGAAG
AAAACGCACCAGTGACGGCCGCCACGCTACTGCGGAGCTGCCTGCGCATGAAACCGACGCGCATCCTGCT
TGCCGAGCTGCGCGGCGGCGAGACTTACGATTTCATCAACGTGGCCGCGTCCGGCCATGGCGGCAGCATC
ACCAGTTGCCATGCCGGTTCGTGCGAACTGACTTTCGAGCGGCTGGCATTGATGGTGTTGCAGAACCGCC
AGGGCCGCCAGTTGCCATACGAGATCATCCGCCGGCTGCTCTATCTGGTGGTGGATGTCGTCGTGCACGT
CCACAATGGCGTGCACGACGGCACTGGCCGCCATATATCTGAAGTTTGGTACGACCCGAATACAAAACGG
GCACTGTCACTGCAACACAGTGAGAAGACGCAATGA
 Primer design