SecReT4
Protein ID: 189022286
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_II00540
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010740] [Browse all T4SS(s) in this replicon]
Location [Strand]57715..58881 [-]
ProductGlutelin
Component typeVirB10
UniProt IDB2SCM7
KEGG IDbmc:BAbS19_II00540
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.7e-61, Aligned region: 201..379
Protein Sequence: 388 a.a.     [Download]
>gi|189022286|ref|YP_001932027.1| Glutelin [Brucella abortus S19]
MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIVVLLLLLVFHMRGNAENNHHSDKTMVQ
TSTVPMRTFKLPPPPPPAPPEPPAPPPAPAMPIAEPAAAALSLPPLPDDTPAKDDVLDKSASALMVVTKS
SGDTNAQTAGDTVVQTTNARIQALLDSQKNTKQDAGSLGTLLHGTQTDARMASLLRNRDFLLAKGSIINC
ALQTRLDSTVPGMAACVVTRNMYSDNGKVLLIERGSTISGEYDANVKQGMARIYVLWTRVKTPNGVVIDL
DSPGADPLGGAGLPGYIDSHFWKRFGGALMLSTIETLGRYATQKVGGGGSNQINLNTGGGESTSNLASTA
LKDTINIPPTLYKNQGEEIGIYIARDLDFSSVYDVKPK
 
Nucleotide Sequence: 1167 bp     [Download]
>gi|189022234|ref|NC_010740.1|:c58881-57715 Brucella abortus S19 chromosome 2, complete sequence
ATGACACAGGAAAACATTCCGGTGCAGCCGGGCACACTTGACGGTGAGCGTGGCCTACCCACCGTGAACG
AAAACGGCTCCGGCCGCACCCGCAAGGTGTTGCTCTTTCTCTTTGTCGTGGGCTTCATCGTCGTGCTGCT
GTTGCTGCTCGTGTTTCACATGAGGGGCAATGCAGAGAATAATCACCATTCAGACAAGACGATGGTGCAG
ACCAGCACAGTTCCGATGCGAACTTTCAAGCTGCCACCCCCGCCACCACCAGCACCACCAGAACCACCAG
CCCCGCCACCGGCCCCAGCCATGCCCATCGCGGAACCCGCAGCGGCGGCGCTGAGCCTGCCACCATTGCC
GGATGATACGCCGGCAAAGGACGATGTACTGGACAAATCGGCCAGCGCGTTGATGGTCGTCACCAAGTCC
AGCGGCGATACGAACGCTCAAACGGCCGGCGATACGGTCGTTCAAACGACCAATGCGCGCATTCAAGCCC
TGCTCGACAGTCAAAAGAACACCAAGCAGGATGCTGGATCGCTGGGTACTCTCCTTCACGGCACACAAAC
GGATGCACGCATGGCGAGCCTTCTGCGCAACCGTGATTTCCTGCTCGCGAAGGGCAGCATCATCAATTGC
GCGCTGCAAACCCGTCTGGATTCGACGGTGCCGGGCATGGCTGCCTGCGTGGTCACACGCAACATGTATA
GCGATAACGGCAAGGTGTTGCTGATTGAGCGCGGTTCAACCATCTCGGGTGAATATGATGCCAACGTAAA
GCAGGGCATGGCTCGCATTTATGTCCTGTGGACGCGCGTGAAGACGCCGAACGGTGTCGTGATCGATCTC
GACTCTCCAGGCGCCGACCCCCTGGGCGGGGCAGGCTTGCCCGGCTACATCGACTCCCACTTCTGGAAGC
GCTTTGGCGGCGCCTTGATGTTGAGCACGATCGAGACCCTCGGCCGCTATGCAACCCAGAAGGTCGGCGG
CGGGGGTTCAAATCAGATCAACCTCAATACCGGCGGAGGTGAATCGACGAGCAACCTGGCTTCAACTGCC
TTGAAGGATACGATCAACATTCCGCCGACACTGTACAAGAACCAGGGCGAAGAGATCGGCATCTATATCG
CCCGCGACCTAGATTTTTCGAGTGTGTATGATGTCAAACCGAAGTGA
 Primer design