SecReT4
Protein ID: 189022287
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_II00550
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010740] [Browse all T4SS(s) in this replicon]
Location [Strand]58878..59747 [-]
ProductType IV secretion system CagX conjugation protein
Component typeVirB9
UniProt IDB2SCM8
KEGG IDbmc:BAbS19_II00550
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.2e-64, Aligned region: 29..259
Protein Sequence: 289 a.a.     [Download]
>gi|189022287|ref|YP_001932028.1| Type IV secretion system CagX conjugation protein [Brucella abortus S19]
MKRFLLACILITLASPSWATKIPSGSKYDSRIQYVDYNSGDVVLVRALPGVGARIVFAPGENIEDVASGF
TQGWEFKASHNILYLKARSMTLSHSNQSIDMAPEPGKWDTNLMVTTDQRMYDFDLRLMPGRNNQRVAYRV
QFRYPAAAAAAAVAAAQKRVVQARMNARPSPVNWNYTMQVGTNSASIAPTLAYDDGRFTYLRFPNNRDFP
AAFLVAEDKSESIVNSHIDPSAPDILVLHRVAKQMVLRLGNKVIGIYNESFNPDGVPARDGTTVPGVKRV
IKSPGENLQ
 
Nucleotide Sequence: 870 bp     [Download]
>gi|189022234|ref|NC_010740.1|:c59747-58878 Brucella abortus S19 chromosome 2, complete sequence
ATGAAAAGATTCCTGCTTGCGTGCATACTGATCACGCTGGCCTCGCCCTCCTGGGCAACCAAAATCCCGT
CCGGCTCAAAATACGACAGCCGAATTCAGTATGTCGATTACAATTCCGGCGATGTCGTGCTGGTTCGGGC
CCTGCCCGGCGTTGGCGCACGCATCGTGTTTGCGCCGGGCGAGAATATTGAGGATGTCGCCTCAGGATTT
ACGCAAGGCTGGGAGTTCAAGGCGAGCCACAACATCCTGTATCTCAAGGCCCGCTCCATGACGCTCTCCC
ACTCGAACCAATCGATCGACATGGCCCCGGAACCGGGCAAGTGGGACACAAACCTGATGGTCACGACAGA
TCAGCGCATGTACGATTTCGATTTGCGCTTGATGCCCGGCCGCAACAATCAGCGTGTTGCCTATCGTGTT
CAGTTCCGCTACCCGGCGGCAGCGGCAGCGGCGGCAGTAGCAGCCGCGCAAAAGCGAGTGGTACAGGCCC
GCATGAATGCCAGACCGTCGCCGGTAAACTGGAACTACACGATGCAGGTCGGCACTAATTCGGCCAGCAT
CGCGCCCACTCTTGCCTATGACGATGGGCGGTTCACATATTTGCGCTTTCCGAACAACAGAGACTTTCCG
GCCGCTTTCCTTGTCGCCGAAGACAAGTCGGAAAGCATCGTGAACAGCCATATAGACCCGTCAGCGCCGG
ACATTCTGGTCCTGCATCGGGTCGCAAAGCAAATGGTGCTGCGCCTCGGTAACAAGGTGATTGGCATCTA
CAACGAATCCTTCAATCCTGATGGCGTTCCCGCACGCGACGGAACCACAGTGCCAGGCGTCAAGCGCGTC
ATCAAATCGCCCGGGGAGAACCTGCAATGA
 Primer design