SecReT4
Protein ID: 189022288
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_II00560
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010740] [Browse all T4SS(s) in this replicon]
Location [Strand]59744..60463 [-]
Productvirulence protein
Component typeVirB8
UniProt IDB2SCM9
KEGG IDbmc:BAbS19_II00560
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.3e-64, Aligned region: 26..234
Protein Sequence: 239 a.a.     [Download]
>gi|189022288|ref|YP_001932029.1| virulence protein [Brucella abortus S19]
MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRAWKIAGAFGTITVLLGIGIAGMLPLKQ
HVPYLVRVNAQTGAPDILTSLDEKSVSYDTVMDKYWLSQYVIARETYDWYTLQKDYETVGMLSSPSEGQS
YASQFQGDKALDKQYGSNVRTSVTIVSIVPNGKGIGTVRFAKTTKRTNETGDGETTHWIATIGYQYVNPS
LMSESARLTNPLGFNVTSYRVDPEMGVVQ
 
Nucleotide Sequence: 720 bp     [Download]
>gi|189022234|ref|NC_010740.1|:c60463-59744 Brucella abortus S19 chromosome 2, complete sequence
ATGTTTGGACGCAAACAATCTCCACAGAAATCAGTAAAGAACGGGCAGGGCAATGCGCCTTCGGTATATG
ACGAAGCGTTGAACTGGGAGGCCGCGCACGTCCGGCTTGTCGAAAAATCCGAACGCCGCGCGTGGAAAAT
CGCCGGGGCTTTCGGCACCATTACCGTGCTGCTCGGGATCGGCATCGCCGGGATGTTACCGCTAAAGCAA
CATGTGCCCTACCTGGTGCGCGTCAACGCACAGACAGGTGCGCCTGATATCCTGACCTCGCTCGACGAGA
AGAGTGTCAGCTACGACACTGTAATGGATAAATACTGGCTCTCGCAGTACGTGATAGCGCGTGAAACCTA
CGACTGGTACACGCTGCAAAAGGACTACGAAACCGTAGGCATGTTGTCGTCGCCGTCCGAAGGGCAGAGC
TATGCAAGCCAGTTCCAGGGCGATAAGGCGCTTGACAAGCAATATGGCTCAAATGTGCGCACATCGGTAA
CGATCGTAAGCATCGTGCCGAACGGCAAGGGCATCGGCACGGTGCGCTTTGCGAAGACGACAAAGCGCAC
CAACGAGACCGGTGACGGCGAAACAACGCACTGGATCGCCACCATTGGCTACCAATACGTCAATCCCTCT
TTGATGTCGGAATCGGCCCGCCTGACAAACCCGCTGGGTTTCAATGTCACGAGCTATCGCGTTGATCCAG
AAATGGGAGTGGTGCAATGA
 Primer design