SecReT4
Protein ID: 189022289
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_II00570
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010740] [Browse all T4SS(s) in this replicon]
Location [Strand]60466..60639 [-]
Producttype IV secretion system protein VirB7 KO
Component typeVirB7
UniProt IDB2SCN0
KEGG IDbmc:BAbS19_II00570
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 57 a.a.     [Download]
>gi|189022289|ref|YP_001932030.1| type IV secretion system protein VirB7 KO [Brucella abortus S19]
MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKPPLAQPNPVDTYED
 
Nucleotide Sequence: 174 bp     [Download]
>gi|189022234|ref|NC_010740.1|:c60639-60466 Brucella abortus S19 chromosome 2, complete sequence
ATGAAAAAGGTAATCCTTGCTTTTGTCGCCACGGCCTTCCTTGCCGGTTGCACTACAACGGGGCCGGCCG
TGGTGCCGGTTCTCGATGGCAAACCGCGGGTTCCCGTCAACAAAAGCGTTCCGGCTAAACCGCCCCTGGC
TCAGCCTAACCCCGTTGACACTTACGAGGACTAA
 Primer design