SecReT4
Protein ID: 189022290
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_II00580
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010740] [Browse all T4SS(s) in this replicon]
Location [Strand]60803..61846 [-]
Producttype IV secretion system protein VirB6
Component typeVirB6
UniProt IDB2SCN1
KEGG IDbmc:BAbS19_II00580
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.1e-47, Aligned region: 42..269
Protein Sequence: 347 a.a.     [Download]
>gi|189022290|ref|YP_001932031.1| type IV secretion system protein VirB6 [Brucella abortus S19]
MVNPVIFEFIGTSIHNQLNNYVTMVASNTMNMIATTAVLAGGLYYTAMGILMSVGRIEGPFSQLVISCIK
FMLIAAFALNISTYSEWVIDTVHNMESGFADAFAGNHGTPSSTIYQTLDNSLGKGWNIAAMLFEKGDNRG
LTQIVQGFSELLLSFLVAGSTLILAGPTGAMIVATNAVIAILLGIGPLFILALGWAPTRGFFDRWFGAIV
TSILQVALLSAVLSISSAIFSRMVAAINLASATQSTLFSCLSLTAVTIVMPYMMYKVYEYGGILGSSISA
ATISLGSLAVNTATSGGGAMTSIFSGSSGGGGSGSAKAGGESSYSAGGNAMWSPAYRQHVLGQFNRD
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|189022234|ref|NC_010740.1|:c61846-60803 Brucella abortus S19 chromosome 2, complete sequence
ATGGTTAATCCTGTAATCTTTGAGTTCATCGGCACTTCGATCCACAACCAGTTGAACAATTACGTGACTA
TGGTGGCATCCAACACCATGAATATGATTGCCACGACTGCTGTCCTCGCCGGTGGCCTCTACTATACCGC
CATGGGCATATTGATGTCTGTGGGGCGGATCGAAGGGCCGTTTTCGCAACTCGTCATAAGCTGTATTAAA
TTCATGCTGATTGCTGCTTTTGCGCTCAATATCAGCACCTATTCGGAGTGGGTGATCGATACGGTGCACA
ACATGGAGTCCGGATTTGCCGACGCCTTTGCCGGCAATCACGGCACCCCTTCCAGCACGATCTACCAGAC
CCTCGACAATTCGTTGGGCAAGGGGTGGAACATCGCAGCCATGCTCTTTGAGAAAGGCGATAATCGCGGC
CTGACCCAGATCGTGCAGGGCTTTTCAGAACTGTTACTGTCATTCCTGGTAGCCGGCTCAACGCTTATCC
TTGCAGGCCCGACTGGTGCGATGATCGTCGCAACCAATGCGGTGATCGCGATCCTGCTCGGAATCGGCCC
TCTCTTCATCCTCGCCCTTGGCTGGGCGCCGACAAGGGGCTTCTTCGATCGCTGGTTCGGGGCCATCGTC
ACATCGATCCTTCAGGTCGCGCTTTTGTCGGCCGTGCTATCTATATCGAGTGCAATCTTCAGCCGCATGG
TGGCGGCCATCAATTTGGCTTCCGCAACACAAAGCACGCTCTTTTCCTGCCTCTCACTGACCGCTGTAAC
GATTGTCATGCCGTATATGATGTACAAGGTCTATGAATACGGTGGCATCCTGGGCAGCAGCATATCGGCG
GCCACGATCTCCCTCGGCTCACTTGCAGTCAATACCGCGACATCTGGTGGTGGCGCTATGACGAGCATAT
TCAGCGGATCATCCGGCGGCGGGGGTTCCGGCTCGGCGAAGGCGGGCGGGGAAAGCAGTTATTCGGCTGG
TGGCAACGCCATGTGGAGCCCGGCTTACCGGCAACACGTGCTCGGCCAGTTCAACAGGGATTAG
 Primer design