SecReT4
Protein ID: 189022291
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_II00590
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010740] [Browse all T4SS(s) in this replicon]
Location [Strand]62030..62746 [-]
Producttype IV secretion system protein VirB5
Component typeVirB5
UniProt IDB2SCN2
KEGG IDbmc:BAbS19_II00590
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 2.2e-66, Aligned region: 21..217
DUF4141 [PF13605], Evalue: 8.4e-07, Aligned region: 1..43
Protein Sequence: 238 a.a.     [Download]
>gi|189022291|ref|YP_001932032.1| type IV secretion system protein VirB5 [Brucella abortus S19]
MKKIILSFAFALTVTSTAHAQLPVTDAGSIAQNLANHLEQMVKFAQQIEQLKQQFEQQKMQFDALTGNRG
LGDILRDPTLRSYLPHNWRDLYEAVMSGGYLAAAGETANLLRKSQVYDPCASISDKDQRIACEAKVVKPV
QDKVMTSKAYDATDKRLQEIESLMQEINKTGDPKAIAELQGRIESENAMIQNEDTRLHLYQQMAEAQDKL
LDERQHELDAKDNARRGYPQPKALEAAY
 
Nucleotide Sequence: 717 bp     [Download]
>gi|189022234|ref|NC_010740.1|:c62746-62030 Brucella abortus S19 chromosome 2, complete sequence
ATGAAGAAGATAATTCTCAGCTTCGCATTCGCCCTGACTGTAACCAGCACGGCGCACGCACAGCTCCCGG
TGACAGATGCCGGCTCCATCGCGCAGAACCTGGCCAACCATCTCGAACAGATGGTGAAGTTCGCCCAGCA
GATCGAGCAACTGAAACAGCAGTTTGAACAACAGAAAATGCAGTTCGATGCCCTGACCGGCAACCGTGGC
CTTGGCGATATTCTCCGCGACCCTACGCTGCGTAGCTATCTGCCACATAACTGGCGAGATCTCTACGAAG
CGGTGATGAGCGGCGGCTACCTGGCGGCGGCTGGCGAAACGGCCAACCTCTTACGCAAAAGCCAGGTATA
CGATCCGTGTGCCTCCATCTCCGACAAAGATCAGCGCATCGCATGTGAGGCTAAAGTGGTGAAGCCGGTC
CAGGACAAGGTCATGACGTCCAAAGCCTACGACGCCACTGACAAACGCCTACAAGAGATCGAGAGCTTGA
TGCAGGAGATCAACAAGACGGGAGACCCGAAGGCGATTGCCGAATTGCAAGGCCGGATCGAAAGCGAAAA
TGCCATGATCCAAAACGAAGACACCCGCCTTCATCTCTACCAGCAGATGGCAGAGGCACAGGACAAGCTC
CTGGACGAACGCCAGCACGAATTAGACGCGAAGGATAATGCCCGGCGCGGCTATCCGCAGCCGAAAGCAC
TGGAAGCCGCCTATTAA
 Primer design