SecReT4
Protein ID: 189022292
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_II00600
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010740] [Browse all T4SS(s) in this replicon]
Location [Strand]62751..65246 [-]
Producttype IV secretion system protein VirB4
Component typeVirB4
UniProt IDB2SCN3
KEGG IDbmc:BAbS19_II00600
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.3e-72, Aligned region: 184..388
AAA_10 [PF12846], Evalue: 7.6e-24, Aligned region: 452..744
Protein Sequence: 831 a.a.     [Download]
>gi|189022292|ref|YP_001932033.1| type IV secretion system protein VirB4 [Brucella abortus S19]
MGAQSKYAQQLNNERSLAPFIPFRSQVGPTTVITRDGDFVRTWRIAGLAFETQDKEKLLIRKDQLNTLFR
AIASNNVALWSHNVRRRTWDHLKSFFSNPFCDALDKKYYGSFSGYRMMSNELYLTVIYRPVPAKISRLFN
VAVHRSHAEILQEQQLAIRKLDEIGNQIETSLRRYGGDDGRGIEVLSTYEDKHGALCSQQLEFYNFLLSG
EWQKVRVPSCPLDEYLGTGWVYAGTETIEIRTANATRYARGIDFKDYANHTEPGILNGLMYSDYEYVITQ
SFSFMTKRDGKEFLTRQKQRLQNTEDGSASQIMEMDIAIDQLGRGDFVMGEYHYSLLVFAEDMETVRHNT
SHAMNILQDNGFLATVIATATDAAFYAQLPCNWRYRPRVAGLTSLNFAGLSCFHNFRAGKRDGNPWGQAL
TLLKTPSGQPAYLNFHYSKGDEDNFDKKLLGNTRIIGQSGAGKTVLMNFCLAQAQKYLHNAPMGMCNVFF
DKDQGAKGTILAIGGKYLAIRNGEPTGFNPFQMEPTAGNILFLEKLVQVLVSRDGQHVTTTDESRISHAI
RTVMRMRPELRRLSTVLQNVTEGSDRQDRENSVAKRLAKWCFDDGTGKRGTFWWVLDCPQDQIDFNTHSN
YGFDGTDFLDNADVRTPISMYLLHRMELAIDGRRFIYWMDEAWKWVDDEAFSEFANNKQLTIRKQNGLGV
FATQMPSSLLNSKVASALVQQVATEIYLPNPKADYHEYTDGFKVTNEEFDIIRSMSEESRMFLVKQGHHS
MICRLELNGFDDELAILSGSSDNNELLDQVIAEVGDDPSVWLPVFQERRKARIASSKSTGR
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|189022234|ref|NC_010740.1|:c65246-62751 Brucella abortus S19 chromosome 2, complete sequence
ATGGGCGCTCAATCCAAATACGCGCAACAGCTCAATAATGAACGGTCACTTGCACCGTTCATTCCCTTCA
GGAGCCAGGTTGGCCCGACCACCGTGATAACGCGTGACGGTGATTTCGTGCGCACATGGCGCATCGCGGG
CCTGGCTTTCGAGACGCAGGACAAGGAGAAACTGTTGATCCGCAAGGACCAGCTTAACACCTTGTTCCGT
GCCATCGCCTCAAACAATGTGGCGCTGTGGTCCCACAACGTACGGCGCAGAACCTGGGATCACTTGAAAT
CCTTCTTTTCCAATCCGTTCTGCGACGCTCTCGACAAGAAGTATTACGGATCGTTTTCCGGCTACCGAAT
GATGTCAAACGAACTGTATCTGACGGTTATTTACCGGCCAGTGCCGGCGAAGATCAGCAGGTTGTTCAAC
GTGGCCGTTCATCGTTCGCATGCGGAAATCTTACAGGAGCAGCAGCTTGCCATCCGCAAGCTGGACGAAA
TCGGCAATCAAATTGAAACCAGCTTGCGTCGCTACGGTGGCGATGACGGGCGTGGCATCGAAGTGCTGAG
CACCTATGAGGACAAACACGGCGCACTGTGCTCACAGCAGCTTGAATTTTATAACTTCCTTCTCTCAGGC
GAATGGCAGAAGGTGCGCGTGCCATCCTGCCCACTGGATGAATATCTGGGCACCGGGTGGGTGTATGCTG
GCACTGAAACCATCGAGATACGCACCGCGAACGCGACGCGCTATGCGCGTGGCATCGATTTCAAGGACTA
TGCGAACCACACCGAGCCGGGCATTTTGAACGGCCTGATGTATAGCGATTACGAGTACGTCATCACACAA
TCCTTCAGCTTCATGACAAAGCGGGATGGCAAGGAGTTCCTGACACGGCAAAAGCAGCGGCTCCAAAATA
CCGAAGACGGCAGCGCATCCCAGATCATGGAAATGGACATTGCCATCGACCAGCTCGGCCGGGGCGATTT
CGTCATGGGTGAATATCATTATTCGCTGCTGGTATTTGCCGAAGACATGGAGACGGTGCGCCACAACACA
TCACATGCGATGAACATCCTGCAAGACAATGGTTTTCTGGCGACGGTGATCGCCACGGCCACGGATGCGG
CGTTCTATGCACAACTGCCATGTAACTGGCGGTATCGGCCGCGCGTGGCGGGCCTGACCTCGCTCAACTT
CGCCGGTCTGTCATGTTTCCATAATTTCCGCGCAGGCAAGCGGGATGGCAACCCCTGGGGGCAGGCATTG
ACGCTGCTCAAAACCCCTTCCGGACAGCCCGCCTACCTGAACTTCCACTATTCAAAAGGCGACGAAGACA
ACTTCGACAAGAAGCTTCTGGGCAATACCCGCATCATCGGCCAGTCCGGCGCTGGTAAAACTGTCCTGAT
GAACTTCTGCCTCGCGCAAGCGCAGAAGTATTTGCACAATGCTCCGATGGGTATGTGCAACGTCTTTTTC
GACAAGGATCAAGGCGCGAAAGGGACTATTCTTGCCATTGGCGGCAAATACCTTGCCATCAGGAACGGCG
AACCCACCGGGTTCAACCCATTCCAGATGGAGCCAACAGCGGGGAACATCCTGTTCCTTGAAAAACTCGT
ACAGGTACTGGTATCGCGTGATGGCCAGCACGTGACCACAACGGACGAAAGCCGGATCAGTCATGCCATA
CGTACGGTCATGCGCATGCGCCCGGAGCTGCGGCGTCTGTCGACGGTGCTGCAAAACGTTACCGAAGGCA
GCGACCGCCAAGATCGTGAAAACAGCGTGGCGAAGCGGCTCGCGAAGTGGTGTTTTGATGACGGCACCGG
CAAGCGGGGCACATTCTGGTGGGTGCTGGATTGCCCGCAAGACCAGATCGACTTCAACACGCATAGCAAT
TACGGTTTCGATGGCACCGACTTCCTCGACAACGCCGACGTGCGTACGCCGATTTCCATGTACCTGCTGC
ATCGTATGGAATTGGCTATCGACGGGCGTCGTTTCATCTACTGGATGGACGAGGCGTGGAAGTGGGTAGA
CGACGAAGCATTCAGCGAGTTCGCCAATAACAAGCAGCTTACCATCCGCAAGCAAAACGGCCTGGGCGTG
TTTGCCACGCAAATGCCCTCCAGCCTGCTCAACTCCAAAGTCGCGTCGGCCCTGGTGCAACAGGTGGCGA
CGGAAATCTATCTGCCGAATCCGAAAGCCGATTATCACGAGTACACGGACGGCTTCAAGGTGACGAACGA
GGAGTTCGACATCATCCGCAGTATGAGCGAGGAAAGCCGCATGTTCCTGGTCAAGCAGGGGCATCATTCG
ATGATTTGCCGCCTGGAGCTTAATGGCTTTGATGACGAACTGGCGATCCTCTCAGGCAGCTCGGACAACA
ACGAGTTGCTGGACCAGGTCATTGCCGAAGTCGGGGACGACCCTTCGGTATGGCTTCCGGTGTTCCAGGA
GCGCCGGAAAGCACGCATTGCGTCGTCCAAATCAACAGGAAGGTGA
 Primer design