SecReT4
Protein ID: 189022293
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_II00610
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010740] [Browse all T4SS(s) in this replicon]
Location [Strand]65246..65596 [-]
ProductType IV secretory pathway, VirB3-like protein
Component typeVirB3
UniProt IDB2SCN4
KEGG IDbmc:BAbS19_II00610
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 3.9e-29, Aligned region: 10..102
Protein Sequence: 116 a.a.     [Download]
>gi|189022293|ref|YP_001932034.1| Type IV secretory pathway, VirB3-like protein [Brucella abortus S19]
MTTAPQESNARSAGYRGDPIFKGCTRPAMLFGVPVIPLVIVGGSIVLLSVWISMFILPLIVPIVLVMRQI
TQTDDQMFRLLGLKAQFRLIHFNRTGRFWRASAYSPIAFTKRKRES
 
Nucleotide Sequence: 351 bp     [Download]
>gi|189022234|ref|NC_010740.1|:c65596-65246 Brucella abortus S19 chromosome 2, complete sequence
ATGACAACGGCACCACAGGAATCCAACGCACGAAGCGCAGGTTATCGCGGCGATCCAATATTCAAGGGCT
GTACACGGCCAGCCATGTTGTTTGGGGTTCCTGTGATCCCGCTTGTCATCGTTGGCGGCAGCATCGTTCT
CTTATCGGTCTGGATTTCCATGTTCATATTGCCGCTGATCGTACCAATCGTGCTGGTCATGCGGCAGATC
ACGCAGACTGACGATCAGATGTTCCGCCTGCTCGGCCTGAAGGCGCAATTCCGCCTGATCCACTTCAACC
GCACCGGGCGCTTCTGGCGGGCATCCGCCTATAGCCCGATTGCCTTCACAAAGCGCAAAAGAGAATCATA
A
 Primer design