SecReT4
Protein ID: 189022294
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_II00620
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010740] [Browse all T4SS(s) in this replicon]
Location [Strand]65610..65927 [-]
Producttype IV secretion system protein VirB2 KO
Component typeVirB2
UniProt IDB2SCN5
KEGG IDbmc:BAbS19_II00620
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.5e-21, Aligned region: 7..103
Protein Sequence: 105 a.a.     [Download]
>gi|189022294|ref|YP_001932035.1| type IV secretion system protein VirB2 KO [Brucella abortus S19]
MKTASPSKKSLSRILPHLLLALIVSIAAIEPNLAHANGGLDKVNTSMQKVLDLLSGVSITIVTIAIIWSG
YKMAFRHARFMDVVPVLGGALVVGAAAEIASYLLR
 
Nucleotide Sequence: 318 bp     [Download]
>gi|189022234|ref|NC_010740.1|:c65927-65610 Brucella abortus S19 chromosome 2, complete sequence
ATGAAAACCGCTTCCCCCAGCAAGAAGTCGCTGTCGCGGATTCTACCTCACCTACTGCTGGCCCTCATTG
TCTCCATCGCTGCAATCGAGCCTAACCTGGCGCACGCCAACGGTGGCCTCGATAAGGTAAATACAAGCAT
GCAAAAAGTGCTGGACTTGCTAAGCGGCGTATCGATCACCATCGTTACCATAGCCATCATCTGGTCCGGT
TACAAGATGGCATTCCGGCACGCCCGCTTCATGGATGTAGTGCCGGTGCTGGGCGGCGCCCTGGTGGTTG
GCGCTGCCGCCGAAATTGCCTCTTACCTGCTTAGGTAA
 Primer design