SecReT4
Protein ID: 189022295
T4SS name [ID]VirB [369]
Gene symbol-
Locus tagBAbS19_II00630
StrainBrucella abortus S19
Repliconchromosome 2 [GenBank: NC_010740] [Browse all T4SS(s) in this replicon]
Location [Strand]66363..67079 [-]
ProductSLT domain-containing protein
Component typeVirB1
UniProt IDB2SCN6
KEGG IDbmc:BAbS19_II00630
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 1.7e-20, Aligned region: 5..136
Protein Sequence: 238 a.a.     [Download]
>gi|189022295|ref|YP_001932036.1| SLT domain-containing protein [Brucella abortus S19]
MVPFLVLAQQCAPTVAPQTMAAIVQVESGFNPYAIGVVGGRLVRQPVSLDEAITTAQSLEAKGWNFSLGI
AQVNRYNLPKYGSTYAQAFDPCKNLKMGSKILEDCYRRAIVKMPGQEQGALRAAFSCYYAGNFTGGFKTK
PGSPSYVQKVVASADVTTKPIVVVPMIRKTPDAAAAVAAPVKKRQPADRNSVLVDLHPSSQSMPATGTAN
APVRLKTEQPATTDAPPGKDNTDGVVVF
 
Nucleotide Sequence: 717 bp     [Download]
>gi|189022234|ref|NC_010740.1|:c67079-66363 Brucella abortus S19 chromosome 2, complete sequence
ATGGTGCCATTCCTTGTCCTCGCGCAACAATGCGCACCGACTGTTGCACCTCAGACTATGGCAGCAATCG
TGCAGGTCGAGTCGGGCTTCAATCCTTATGCAATAGGCGTCGTTGGTGGGCGGTTGGTCCGTCAACCCGT
TTCCCTTGATGAAGCAATCACGACAGCACAGTCACTGGAAGCCAAAGGCTGGAATTTCTCTTTGGGTATT
GCTCAAGTCAACAGGTACAATCTGCCGAAATATGGCAGCACCTACGCACAAGCGTTCGACCCCTGCAAGA
ACCTGAAGATGGGATCCAAGATCCTTGAAGACTGCTACCGTCGGGCCATCGTGAAGATGCCCGGTCAGGA
ACAAGGCGCGCTTCGCGCCGCATTCTCCTGTTACTACGCCGGCAACTTTACGGGCGGCTTCAAGACGAAG
CCCGGCAGTCCCAGCTACGTGCAGAAGGTCGTGGCAAGCGCCGACGTGACCACAAAGCCGATTGTTGTCG
TGCCCATGATCCGGAAAACGCCGGATGCGGCGGCAGCAGTAGCTGCCCCAGTAAAAAAACGACAGCCGGC
TGATCGTAATTCTGTTCTTGTCGATCTGCATCCATCATCGCAGTCGATGCCAGCCACCGGCACGGCGAAC
GCGCCTGTAAGGCTGAAGACAGAGCAGCCGGCGACAACCGATGCGCCGCCAGGGAAGGATAATACGGACG
GCGTAGTTGTTTTCTAA
 Primer design