SecReT4
Protein ID: 189183116
T4SS name [ID]Tra_F [567]
Gene symbol-
Locus tagOTT_0209
StrainOrientia tsutsugamushi str. Ikeda
Repliconchromosome [GenBank: NC_010793] [Browse all T4SS(s) in this replicon]
Location [Strand]199662..200384 [-]
Productconjugative transfer protein TraF
Component typeTraF_F
UniProt IDB3CS74
KEGG IDott:OTT_0209, ott:OTT_1917
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.8e-53, Aligned region: 29..228
Protein Sequence: 240 a.a.     [Download]
>gi|189183116|ref|YP_001936901.1| conjugative transfer protein TraF [Orientia tsutsugamushi str. Ikeda]
MNPLAIMLTIGLLNYLSIELATANSLPTGFLWYNDKHGHEPNESSANSKLMSRPHDHRIEELKEQFNRAQ
RIALDNPTLENVITAQRLQKQIMEKAHKFATMWQLATLLDYQLINANEPANSLHRKLYQEKSEQENDSKL
KNIAKNWGLILQVKEDCLLCKAFIPIVQSFANKYAFQLLAVSKNNELLNKLNPKHIVPVLYLVASDGKKI
YAVARGIISEDKIIDNILAIDRYYHKLETR
 
Nucleotide Sequence: 723 bp     [Download]
>gi|189182907|ref|NC_010793.1|:c200384-199662 Orientia tsutsugamushi str. Ikeda, complete genome
ATGAATCCATTAGCAATAATGCTAACTATTGGGCTACTTAATTACTTGTCGATAGAATTAGCTACTGCTA
ACTCTTTGCCTACAGGGTTTTTATGGTACAATGATAAACATGGTCATGAGCCTAATGAATCTTCAGCTAA
TTCTAAGTTGATGAGTAGGCCTCATGATCATAGAATTGAGGAATTAAAGGAGCAATTTAATCGAGCTCAG
CGTATAGCGCTTGATAATCCAACGCTCGAAAATGTGATTACAGCTCAAAGGCTACAGAAACAAATCATGG
AGAAGGCGCATAAGTTTGCTACTATGTGGCAACTAGCTACTCTACTTGATTATCAACTGATTAATGCTAA
TGAGCCTGCTAATAGCTTACATAGAAAACTGTATCAAGAAAAATCAGAACAAGAAAACGACTCAAAACTT
AAAAACATTGCTAAAAACTGGGGATTAATTTTGCAAGTTAAAGAAGATTGCTTGCTATGTAAGGCCTTTA
TTCCTATTGTTCAGAGCTTTGCTAATAAATATGCATTTCAGTTGCTAGCTGTCAGTAAGAATAATGAGTT
GCTTAATAAACTAAATCCTAAGCATATTGTACCTGTATTATATCTAGTAGCTAGCGATGGTAAAAAAATA
TATGCAGTAGCTAGAGGCATAATTTCTGAAGATAAAATTATCGACAATATTCTAGCAATCGATAGATATT
ATCATAAGTTGGAGACTAGATGA
 Primer design