SecReT4
Protein ID: 189183399
T4SS name [ID]Tra_F [565]
Gene symbol-
Locus tagOTT_0492
StrainOrientia tsutsugamushi str. Ikeda
Repliconchromosome [GenBank: NC_010793] [Browse all T4SS(s) in this replicon]
Location [Strand]509500..510126 [+]
Productconjugative transfer protein TraF
Component typeTraF_F
UniProt IDB3CQV8
KEGG IDott:OTT_0407, ott:OTT_0492, ott:OTT_1608
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3.4e-42, Aligned region: 23..202
Protein Sequence: 208 a.a.     [Download]
>gi|189183399|ref|YP_001937184.1| conjugative transfer protein TraF [Orientia tsutsugamushi str. Ikeda]
MSRLLMFMILISHLSTVDASPTGFLWYNDKHDHELNKSASNSELILAVHDHRIEELKEQFNRAQRIALDN
PTLENVITAQRLQKQIMEKAHKFATMWQLATLLDYQLINANEPSNSLHRKLYQEKSEQKNDLKLKNIAKN
WGLILQVKQDCLLCKAFMPIVQGFANKYAFQLLAVSKNNELLNKLNPKHVVPVLYLVASDGKKNICSS
 
Nucleotide Sequence: 627 bp     [Download]
>gi|189182907|ref|NC_010793.1|:509500-510126 Orientia tsutsugamushi str. Ikeda, complete genome
ATGAGCAGATTACTAATGTTTATGATATTAATTAGTCATTTATCCACTGTTGATGCTTCACCAACAGGAT
TTCTATGGTATAATGATAAACATGATCATGAGCTGAATAAATCTGCTTCTAATTCTGAGCTGATATTGGC
TGTCCATGACCATAGAATCGAGGAATTAAAGGAGCAATTTAATCGAGCTCAGCGTATAGCGCTTGATAAT
CCAACGCTCGAAAATGTGATTACAGCTCAAAGGCTACAGAAACAAATCATGGAGAAGGCACATAAGTTTG
CTACTATGTGGCAACTAGCTACTTTACTTGATTATCAACTGATTAATGCTAATGAGCCATCTAATAGCTT
ACATAGAAAGCTGTATCAAGAAAAATCAGAGCAGAAAAACGACTTAAAACTCAAAAACATTGCTAAAAAC
TGGGGCTTGATTCTGCAAGTTAAACAAGATTGCTTGCTATGTAAGGCCTTTATGCCTATTGTTCAGGGCT
TTGCTAATAAATATGCATTTCAGTTGCTAGCTGTCAGTAAGAATAATGAGTTGCTAAATAAACTAAACCC
TAAGCATGTTGTGCCTGTATTATATCTAGTAGCTAGCGATGGTAAAAAAAATATATGCAGTAGCTAG
 Primer design