SecReT4
Protein ID: 189183984
T4SS name [ID]VirB [507]
Gene symbolvirB8
Locus tagOTT_1077
StrainOrientia tsutsugamushi str. Ikeda
Repliconchromosome [GenBank: NC_010793] [Browse all T4SS(s) in this replicon]
Location [Strand]1108251..1108952 [+]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDB3CT38
KEGG IDott:OTT_1077
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.6e-18, Aligned region: 23..224
Protein Sequence: 233 a.a.     [Download]
>gi|189183984|ref|YP_001937769.1| type IV secretion system protein VirB8 [Orientia tsutsugamushi str. Ikeda]
MLMDNSEIAVDIKNSKYFQDAYVWYKAKYLYPLLHRSVVFIILALLLLLIVLSIINVYSLLPVTQSLKYI
ISVDEKFNAAAKITSADQVLKNPLQSIVKILAESYVVKRESYNYSQLASQFQYIKNRSTRGIFRQFVNYM
SLQNYQSPVLRYQKTAKRKIKILSSVFLNNDELAVYFHSCAIDDKGNMVEDMKWKANIIFETDQVNLNAA
SGSIFKFFVTDYKITLLQNNNEK
 
Nucleotide Sequence: 702 bp     [Download]
>gi|189182907|ref|NC_010793.1|:1108251-1108952 Orientia tsutsugamushi str. Ikeda, complete genome
ATGCTAATGGATAATAGTGAAATAGCAGTTGATATTAAAAATAGTAAATACTTTCAAGATGCTTATGTGT
GGTATAAAGCTAAGTATCTTTACCCATTGCTACATCGGTCTGTAGTATTTATTATACTAGCGTTATTATT
GCTATTAATAGTACTAAGTATAATTAATGTTTATAGCTTGCTGCCTGTTACACAATCACTAAAATATATT
ATTTCAGTAGATGAAAAATTTAATGCTGCTGCAAAAATAACCTCTGCAGATCAAGTACTTAAAAATCCAC
TTCAATCTATAGTAAAAATTTTAGCTGAAAGCTATGTTGTAAAACGTGAAAGTTACAACTACAGTCAACT
TGCTAGTCAATTTCAATATATCAAGAATAGATCTACGCGAGGAATATTTAGACAATTTGTTAATTATATG
AGTCTTCAAAATTATCAGTCTCCTGTATTAAGATATCAAAAGACTGCTAAGCGTAAAATTAAGATTTTAT
CATCAGTATTTCTTAATAATGATGAGTTAGCTGTATATTTTCACTCCTGTGCCATAGATGATAAAGGTAA
TATGGTTGAAGATATGAAGTGGAAAGCAAACATTATTTTTGAAACAGATCAAGTTAATTTAAATGCTGCA
TCTGGTTCAATTTTTAAATTTTTTGTAACAGATTATAAAATAACATTACTACAGAATAATAATGAGAAAT
AG
 Primer design