SecReT4
Protein ID: 189184398
T4SS name [ID]Tra_F [563]
Gene symbol-
Locus tagOTT_1491
StrainOrientia tsutsugamushi str. Ikeda
Repliconchromosome [GenBank: NC_010793] [Browse all T4SS(s) in this replicon]
Location [Strand]1521627..1522325 [-]
Productconjugative transfer protein TraF
Component typeTraF_F
UniProt IDB3CSB7
KEGG IDott:OTT_0860, ott:OTT_1144, ott:OTT_1491
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.3e-49, Aligned region: 23..220
Protein Sequence: 232 a.a.     [Download]
>gi|189184398|ref|YP_001938183.1| conjugative transfer protein TraF [Orientia tsutsugamushi str. Ikeda]
MSRLLMVMILISQLSTVDASPTGFLWYNDKHDHELNNSSSKLMSGTHDHRIEELKEQFNRAQRIALDNPT
LENVITAQRLQKQIMEKAHKFATMWQLATLLDYQLINANEPSNSLHRKLYQEKSEQKNDSKLKNIAKNWG
LILQVKQDCLLCKAFIPIVQSFANKYAFQLLAVSKNNELLNKLNPKHVVPVLYSVASDGKKIYAVARGII
SENKIIDNILAIDRYYHKLETR
 
Nucleotide Sequence: 699 bp     [Download]
>gi|189182907|ref|NC_010793.1|:c1522325-1521627 Orientia tsutsugamushi str. Ikeda, complete genome
ATGAGCAGATTACTAATGGTTATGATATTAATTAGTCAATTATCTACAGTTGATGCTTCGCCCACAGGAT
TTCTATGGTACAATGATAAACATGATCATGAGCTTAATAACTCTAGTTCTAAGTTGATGAGTGGGACTCA
TGATCATAGAATCGAGGAATTAAAGGAGCAATTTAATCGAGCTCAGCGTATAGCGCTTGATAATCCAACG
CTCGAAAATGTGATTACAGCTCAAAGATTGCAGAAGCAAATCATGGAGAAGGCGCATAAGTTTGCTACTA
TGTGGCAGCTAGCTACTCTACTTGATTATCAACTGATTAACGCTAATGAGCCATCTAATAGCTTACATAG
AAAGCTGTATCAAGAAAAATCAGAGCAGAAAAACGACTCAAAACTCAAAAACATTGCTAAAAACTGGGGC
TTGATTCTGCAAGTTAAACAAGATTGCTTGCTATGTAAGGCCTTTATTCCTATTGTTCAGAGCTTTGCTA
ATAAATATGCATTTCAGTTGCTAGCTGTCAGTAAGAATAATGAGTTGCTTAATAAACTAAATCCTAAGCA
TGTTGTGCCTGTATTATATTCAGTAGCTAGCGATGGTAAAAAAATATATGCAGTAGCTAGAGGCATAATC
TCTGAGAATAAAATTATCGACAATATTCTAGCAATCGATAGATATTATCATAAGTTGGAGACTAGATGA
 Primer design