SecReT4
Protein ID: 189184474
T4SS name [ID]VirB [507]
Gene symbolvirD4
Locus tagOTT_1567
StrainOrientia tsutsugamushi str. Ikeda
Repliconchromosome [GenBank: NC_010793] [Browse all T4SS(s) in this replicon]
Location [Strand]1594095..1595867 [-]
Producttype IV secretion system component VirD4
Component typeVirD4
UniProt IDB3CUH8
KEGG IDott:OTT_1567
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5.9e-160, Aligned region: 122..568
TraG-D_C [PF12696], Evalue: 3.7e-28, Aligned region: 406..528
TrwB_AAD_bind [PF10412], Evalue: 4.8e-20, Aligned region: 238..536
Protein Sequence: 590 a.a.     [Download]
>gi|189184474|ref|YP_001938259.1| type IV secretion system component VirD4 [Orientia tsutsugamushi str. Ikeda]
MNENAFLTKIRNLVIKIMVHCIGVILVVFIIKFFILLFTVKHQNLIDVLLTFNVSIVYQYLIWIINSWSL
IDFSSYDYLKLKLVFSFIVPPVITIVLYIKNFEKIKSWQPYKLKEKVYGDARWGDQDDIKRAGLRSKHGT
LLGVDKGGYYVADGFQHALLFAPTGSGKGVGFVIPNLLFWEHSVIVHDIKLENYELTSGWRAQQGQNVYV
WEPANPDGITHCYNPIDWVSSKPGQMVDDVQKIANLIMPEKDFWNNEARSLFLGVVLYLIADNTKAKTFG
EVVRTMRSNDVVYNLAVVLDTMGAVIHPVAYMNIAAFLQKADKERSGVISTMNSGLELWANPLIDAATAS
SDFNILEIKRKKTTIYVGLTPDNINRLQKLMQVFYQQSTEFLSRKIPDVKEEPYGVMFLLDEFPTLGKME
QFKTGIAYFRGYRVRLFLIIQDTQQLKGTYEEAGMNSFLSNSTYRITFAANNYETANLISQLCGNKTVKQ
ASHSQPRFFDLNPATRTMNISEVQRALLLPQEVILLPRDEQIILIESFPPIRSKKVKYYEDKFFTSRLLP
PSFVPTQTPYVPPDYNATADDSNNVDNNQK
 
Nucleotide Sequence: 1773 bp     [Download]
>gi|189182907|ref|NC_010793.1|:c1595867-1594095 Orientia tsutsugamushi str. Ikeda, complete genome
ATGAATGAGAATGCATTTTTAACTAAGATTAGAAATCTAGTTATAAAGATAATGGTTCATTGTATTGGAG
TAATATTAGTAGTTTTCATTATTAAATTTTTTATACTCTTATTTACTGTTAAACATCAAAATTTAATAGA
TGTATTACTAACTTTTAATGTATCCATTGTATATCAATATCTAATCTGGATTATAAATTCTTGGAGTTTA
ATTGATTTTAGTAGTTATGATTACTTAAAACTTAAATTAGTATTTTCATTTATAGTTCCACCTGTTATAA
CTATAGTGTTATATATCAAAAATTTCGAGAAAATTAAGAGTTGGCAACCATATAAATTGAAAGAAAAAGT
ATACGGTGATGCACGTTGGGGAGATCAAGACGATATAAAAAGAGCTGGTCTTAGATCAAAACATGGTACA
TTGTTAGGTGTAGATAAGGGAGGATACTATGTTGCAGATGGATTTCAACATGCTTTATTATTTGCTCCTA
CTGGTTCAGGTAAAGGGGTAGGTTTTGTAATTCCAAACTTATTATTTTGGGAACATTCAGTAATAGTTCA
CGATATTAAGCTTGAAAATTATGAATTAACTAGTGGCTGGCGAGCTCAGCAAGGACAAAATGTTTATGTA
TGGGAGCCAGCTAATCCAGATGGTATTACTCATTGTTATAATCCAATAGATTGGGTTAGTAGTAAACCTG
GGCAGATGGTTGATGATGTGCAGAAAATTGCTAACCTAATTATGCCAGAAAAAGACTTTTGGAATAATGA
GGCTAGAAGTCTGTTTTTAGGAGTTGTATTATACTTAATTGCTGATAATACAAAAGCTAAAACATTTGGT
GAAGTGGTTCGTACTATGCGCAGTAATGATGTAGTATATAATTTAGCAGTAGTATTAGATACTATGGGAG
CAGTTATTCATCCAGTTGCTTATATGAATATTGCTGCTTTTCTTCAAAAAGCTGATAAAGAACGCTCTGG
AGTAATATCAACTATGAATTCTGGTCTTGAATTATGGGCCAATCCATTAATCGATGCTGCAACTGCTTCA
TCAGATTTCAATATCTTAGAAATAAAAAGAAAAAAAACAACAATATACGTTGGCTTAACACCTGATAATA
TCAATAGATTGCAAAAATTAATGCAAGTATTTTATCAACAGTCTACTGAATTTTTGAGCAGAAAAATTCC
TGATGTTAAGGAAGAACCTTATGGAGTAATGTTTCTATTGGATGAGTTTCCAACTTTAGGTAAAATGGAA
CAATTTAAAACTGGAATTGCTTATTTTCGAGGTTATAGAGTAAGGCTATTTTTGATTATTCAAGATACGC
AGCAGTTAAAAGGAACATATGAAGAAGCAGGAATGAATTCATTTTTATCTAATTCTACTTATAGAATTAC
ATTTGCTGCTAACAATTATGAGACTGCTAACTTGATATCACAGTTATGTGGCAATAAAACAGTTAAACAA
GCTTCACATAGTCAACCTCGCTTTTTTGACCTTAATCCAGCTACTAGAACTATGAATATTTCTGAAGTAC
AAAGAGCATTATTATTACCACAAGAGGTTATTTTATTGCCACGCGATGAGCAAATTATTTTAATTGAATC
GTTTCCACCAATACGATCTAAAAAGGTTAAATATTATGAGGATAAGTTTTTTACTAGTAGATTACTGCCA
CCTTCATTTGTTCCAACTCAAACACCTTATGTTCCTCCAGATTATAATGCTACAGCTGATGATAGTAATA
ACGTAGACAATAATCAAAAATAA
 Primer design