SecReT4
Protein ID: 189184475
T4SS name [ID]VirB [507]
Gene symbolvirB11
Locus tagOTT_1568
StrainOrientia tsutsugamushi str. Ikeda
Repliconchromosome [GenBank: NC_010793] [Browse all T4SS(s) in this replicon]
Location [Strand]1595867..1596856 [-]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDB3CUH9
KEGG IDott:OTT_1568
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.4e-90, Aligned region: 12..310
Protein Sequence: 329 a.a.     [Download]
>gi|189184475|ref|YP_001938260.1| type IV secretion system ATPase VirB11 [Orientia tsutsugamushi str. Ikeda]
MKNNIALETYLTPFKLIFDEAGVNEVMINRPGEVWVEKKGSYRQELMKDLDFSHLAALARLIAQSTEQVI
SEEKPLLSATLPNGYRVQVVFPPACEVGSIGIAIRKVSSLNMTLEDYNKTGAFDYTAIDEVIDENDKILS
EYLINKQFKNFLQHAIKSKKNIIISGGTSSGKTTFTNSALLEVPHTERLITVEDAREISIPNHPNRLHLL
ASKGNQGRAKVTTQDLIEACLRLRPDRIIIGELRGAEAFSFLRAINTGHPGSISTLHADTTAMALEQLKL
MVMQAGLGMPPDEIKNYINAVIDIVVQLKRGDRGIRYISEIYFKKMRKK
 
Nucleotide Sequence: 990 bp     [Download]
>gi|189182907|ref|NC_010793.1|:c1596856-1595867 Orientia tsutsugamushi str. Ikeda, complete genome
ATGAAGAATAATATTGCACTTGAAACCTATTTAACTCCTTTTAAATTAATTTTTGATGAAGCAGGAGTAA
ATGAGGTGATGATTAACCGCCCTGGTGAGGTTTGGGTTGAAAAAAAGGGAAGCTATCGTCAAGAATTAAT
GAAAGATCTAGATTTTAGTCATTTAGCTGCTTTAGCTAGGTTAATAGCTCAGTCAACTGAACAAGTTATT
TCTGAAGAAAAACCATTACTTTCAGCTACTCTACCTAATGGCTATAGAGTGCAGGTAGTTTTTCCACCAG
CTTGTGAAGTTGGATCAATAGGTATAGCTATTAGAAAAGTATCTTCTTTAAATATGACTTTAGAAGATTA
TAATAAAACAGGAGCATTTGATTACACGGCGATTGATGAAGTAATTGATGAAAATGATAAAATACTTAGT
GAATACCTTATTAATAAACAATTCAAAAATTTTTTGCAGCATGCAATAAAGTCCAAAAAAAATATTATTA
TTAGCGGTGGTACCTCTAGTGGTAAAACAACTTTTACTAATTCAGCTTTATTAGAAGTTCCGCATACAGA
AAGACTAATTACTGTTGAAGATGCTAGAGAAATTAGCATACCTAATCATCCAAATCGCTTGCATTTATTA
GCTTCAAAAGGAAATCAAGGACGAGCAAAGGTTACTACTCAAGATTTAATTGAAGCTTGTTTAAGGCTAA
GGCCTGATAGAATAATAATTGGTGAGTTGCGAGGAGCAGAAGCATTTAGTTTTTTACGTGCTATTAATAC
AGGGCATCCAGGATCAATATCAACTTTACATGCAGATACTACTGCAATGGCTTTGGAGCAGTTAAAATTA
ATGGTAATGCAAGCTGGACTAGGAATGCCGCCAGATGAAATCAAAAACTATATTAATGCAGTAATTGATA
TAGTAGTGCAATTGAAGCGTGGTGATCGTGGAATTAGATATATTTCTGAAATATATTTTAAAAAAATGAG
AAAAAAATAA
 Primer design