SecReT4
Protein ID: 189184478
T4SS name [ID]VirB [507]
Gene symbolvirB8
Locus tagOTT_1571
StrainOrientia tsutsugamushi str. Ikeda
Repliconchromosome [GenBank: NC_010793] [Browse all T4SS(s) in this replicon]
Location [Strand]1598806..1599486 [-]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDB3CUI2
KEGG IDott:OTT_1571
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.4e-43, Aligned region: 20..224
Protein Sequence: 226 a.a.     [Download]
>gi|189184478|ref|YP_001938263.1| type IV secretion system protein VirB8 [Orientia tsutsugamushi str. Ikeda]
MFFWKNKKKVEQQKQNKPAIKSWFNDHYETVLVQRNIAVLLSFICIILIFIAVVAVMKISLARNFEPFVI
QIEEKTGATRVVNPVGIEVLNTEKALAQYFIKLYISARETYNPVDFEIKARQTIKLLSNNNVYWSYLNFI
NRKENDPRLIYGQRETTTLKVRSWSELPDRRFIVRIAIHESISGKVFNKIVVVQYQYVPMELSPEEFDIN
PVGFQIIGYRIDDDYS
 
Nucleotide Sequence: 681 bp     [Download]
>gi|189182907|ref|NC_010793.1|:c1599486-1598806 Orientia tsutsugamushi str. Ikeda, complete genome
ATGTTTTTTTGGAAAAATAAAAAGAAAGTTGAACAGCAAAAGCAAAATAAGCCTGCTATAAAAAGTTGGT
TTAATGATCATTATGAAACTGTTTTGGTACAGCGTAACATTGCTGTATTGTTATCATTTATATGTATAAT
ATTAATTTTTATAGCAGTAGTTGCTGTGATGAAAATATCTTTAGCAAGAAATTTTGAACCATTTGTAATA
CAGATTGAAGAGAAAACTGGGGCAACCAGAGTTGTTAATCCAGTTGGAATTGAAGTATTAAATACTGAAA
AAGCGTTAGCGCAATATTTTATTAAATTATATATTTCTGCTAGGGAAACATATAATCCAGTAGATTTTGA
GATTAAAGCTAGACAAACTATTAAATTATTGTCTAATAACAATGTTTATTGGTCATATTTGAATTTTATT
AATCGAAAGGAAAATGATCCAAGGTTAATATATGGGCAACGTGAAACTACAACATTAAAAGTTAGATCAT
GGTCAGAGTTGCCTGACAGAAGGTTTATTGTTCGAATTGCAATACATGAATCTATAAGCGGAAAGGTATT
TAATAAGATTGTTGTAGTACAGTATCAATATGTTCCTATGGAACTTTCTCCTGAAGAATTTGATATTAAT
CCAGTAGGTTTTCAAATTATAGGATATAGAATAGATGATGATTATAGTTAG
 Primer design