SecReT4
Protein ID: 189184622
T4SS name [ID]Tra_F [562]
Gene symbol-
Locus tagOTT_1715
StrainOrientia tsutsugamushi str. Ikeda
Repliconchromosome [GenBank: NC_010793] [Browse all T4SS(s) in this replicon]
Location [Strand]1737604..1738302 [+]
Productconjugative transfer protein TraF
Component typeTraF_F
UniProt IDB3CUX6
KEGG IDott:OTT_1715
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 6.8e-50, Aligned region: 23..220
Protein Sequence: 232 a.a.     [Download]
>gi|189184622|ref|YP_001938407.1| conjugative transfer protein TraF [Orientia tsutsugamushi str. Ikeda]
MSRLLMVIILISQLSTVVASPTGFLWYNDKHGHEPNDSTSKLMSIAHDQRIEELKEQFNRAQRIALDNPT
LENVITAQRLQKQIMEKAHKFATMWQLATLLDYQLINANEPANSLHRKLYQEKSEQENDSKLKNIAKNWG
LILQVKQDCLLCKAFLPVVQSFVNKYAFQLLAVSKNNELLNKLNPEHIVPVLYLIAANGKKIYSVARGII
SEDKIIDNILAIDRHYHKLETA
 
Nucleotide Sequence: 699 bp     [Download]
>gi|189182907|ref|NC_010793.1|:1737604-1738302 Orientia tsutsugamushi str. Ikeda, complete genome
ATGAGCAGATTACTAATGGTTATAATATTAATTAGTCAATTATCTACAGTTGTCGCTTCGCCAACAGGTT
TTTTATGGTATAATGATAAACATGGTCATGAGCCTAATGACTCTACTTCAAAGTTGATGAGTATCGCTCA
TGACCAGAGAATCGAGGAATTAAAGGAGCAATTTAATCGAGCTCAGCGTATAGCGCTTGATAATCCAACG
CTCGAAAATGTGATTACAGCTCAAAGGCTACAGAAACAAATCATGGAGAAGGCGCATAAGTTTGCTACTA
TGTGGCAACTAGCTACTCTACTTGATTATCAGTTGATTAATGCTAATGAGCCTGCTAATAGCTTACATAG
AAAACTGTATCAAGAAAAATCAGAACAAGAAAACGACTCAAAACTTAAAAACATTGCTAAAAACTGGGGA
TTGATTCTGCAAGTTAAACAAGATTGCTTGCTCTGTAAAGCCTTTCTTCCTGTTGTTCAGAGCTTTGTTA
ATAAATATGCATTTCAGCTGCTAGCTGTCAGTAAGAATAATGAATTGCTAAATAAACTAAACCCTGAACA
CATTGTACCTGTGTTATATTTGATTGCTGCAAATGGTAAGAAAATATATTCAGTAGCTAGAGGCATAATC
TCTGAGGATAAAATTATCGACAATATTCTAGCAATCGATAGACATTATCATAAGTTGGAGACTGCATGA
 Primer design