SecReT4
Protein ID: 189184734
T4SS name [ID]Tra_F [561]
Gene symbol-
Locus tagOTT_1827
StrainOrientia tsutsugamushi str. Ikeda
Repliconchromosome [GenBank: NC_010793] [Browse all T4SS(s) in this replicon]
Location [Strand]1857694..1858398 [+]
Productconjugative transfer protein TraF
Component typeTraF_F
UniProt IDB3CV88
KEGG IDott:OTT_1827
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 4.4e-51, Aligned region: 23..222
Protein Sequence: 234 a.a.     [Download]
>gi|189184734|ref|YP_001938519.1| conjugative transfer protein TraF [Orientia tsutsugamushi str. Ikeda]
MSRLLMVMILISSFSTVDASPTGFLWYNDKRGHEPNEFATNSKLIHAAHDHRIEELKEQFNRAQRIALDN
PTLENVITAQRLQKQIMEKAHKFATMWQLATLLDYQLINAHEPSNSLHRKLYQEKSEQKNDLKLKNIAKN
WGLILQVKQDCLLCKAFIPIVQSFANKYAFQLLAVSKNNELLNKLNPKHVVPVLYLVASDGKKIYAVARS
IISEDKIIDNILAIDRYYHKLETR
 
Nucleotide Sequence: 705 bp     [Download]
>gi|189182907|ref|NC_010793.1|:1857694-1858398 Orientia tsutsugamushi str. Ikeda, complete genome
ATGAGCAGATTACTAATGGTTATGATATTAATTAGTAGTTTTTCCACTGTTGATGCTTCACCAACAGGTT
TTTTATGGTACAATGATAAACGTGGTCATGAGCCTAATGAATTTGCTACTAATTCTAAGCTGATACACGC
GGCTCATGATCATAGAATTGAAGAGTTAAAAGAGCAATTTAATCGAGCTCAGCGTATAGCGCTTGATAAT
CCAACGCTCGAAAATGTGATTACAGCCCAAAGATTGCAGAAGCAAATCATGGAGAAGGCGCATAAGTTTG
CTACTATGTGGCAACTAGCTACTCTACTTGATTATCAACTAATTAATGCTCATGAGCCATCTAATAGCTT
ACATAGAAAACTGTATCAAGAAAAATCAGAGCAGAAAAACGACTTAAAACTCAAAAACATTGCTAAAAAC
TGGGGCTTGATTCTGCAAGTAAAACAAGATTGCTTGCTCTGTAAGGCCTTTATTCCTATTGTTCAGAGCT
TTGCTAATAAATATGCATTTCAGTTGCTAGCTGTTAGTAAGAATAATGAGTTGCTGAATAAATTAAATCC
TAAGCATGTTGTACCTGTGTTATACCTAGTAGCTAGCGATGGTAAAAAAATATATGCAGTAGCTAGAAGC
ATAATCTCTGAAGATAAAATTATCGACAATATTCTAGCAATCGATAGATATTATCATAAATTGGAGACTA
GATGA
 Primer design