SecReT4
Protein ID: 189348494
T4SS name [ID]Trb [791]
Gene symboltrbL
Locus tagBMULJ_05893
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome 3 [GenBank: NC_010801] [Browse all T4SS(s) in this replicon]
Location [Strand]603826..604728 [-]
Producttype IV secretion system protein
Component typeTrbL
UniProt IDB3DAV2
KEGG IDbmj:BMULJ_05893
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5.2e-17, Aligned region: 60..275
Protein Sequence: 300 a.a.     [Download]
>gi|189348494|ref|YP_001941690.1| type IV secretion system protein [Burkholderia multivorans ATCC 17616]
MSSGWSSSYVNGEVAKGASAAIDTIGQIMKDLIDLAVELSRTLDKESNKMAFGLSVTTVVLASLRFGATK
DPIAAWQSLFEDLAILGIFAAIYIAYDRWAPGFYKWFNEMAIAISGTDADSLPMAMVKSAGAIYDSVIEA
LKAEHWWNYIALLINLAPLLFAWLFLMLAALVFLFYVSLGTIQMAVAIVMGKIAFALGMSEFTRGWFKSW
LDYTISAGMYMVVAAILQRLMTTTIAKSFGDTISKGLTTPYAGSLTLDMSIFVLILAFEIPKFASMFGGG
ASASGSAFKSLTKMATKGLA
 
Nucleotide Sequence: 903 bp     [Download]
>gi|189347993|ref|NC_010801.1|:c604728-603826 Burkholderia multivorans ATCC 17616 chromosome 3, complete sequence
ATGTCATCTGGCTGGAGCTCGAGCTACGTGAACGGTGAGGTCGCGAAGGGTGCCAGCGCCGCGATCGATA
CGATCGGGCAGATCATGAAGGATCTGATCGATCTCGCTGTCGAACTCTCCAGGACGCTCGACAAGGAATC
CAACAAGATGGCGTTCGGGCTATCGGTCACGACGGTCGTGCTGGCGTCGCTTAGGTTCGGTGCGACCAAG
GATCCAATCGCCGCCTGGCAGAGTTTGTTCGAAGACCTCGCGATACTGGGCATCTTTGCGGCGATCTACA
TTGCGTACGACAGATGGGCGCCCGGGTTCTACAAGTGGTTTAACGAGATGGCGATCGCGATTTCAGGAAC
CGACGCGGATTCGTTGCCGATGGCGATGGTGAAGTCGGCCGGCGCGATCTATGACTCGGTCATCGAAGCA
CTGAAGGCAGAGCATTGGTGGAACTACATCGCGCTGTTGATCAACCTTGCACCGCTGCTATTCGCATGGT
TGTTCCTGATGCTGGCGGCCCTCGTGTTTCTCTTCTATGTCTCGTTGGGCACGATTCAAATGGCCGTCGC
GATCGTGATGGGCAAGATTGCATTCGCACTCGGCATGTCGGAGTTCACGCGAGGATGGTTCAAGAGCTGG
CTCGATTACACGATCAGCGCAGGCATGTATATGGTCGTCGCCGCAATTCTTCAGCGTCTGATGACCACAA
CCATCGCGAAGTCGTTCGGGGACACGATATCGAAGGGACTGACGACGCCGTATGCCGGGTCGCTCACGCT
GGACATGTCAATCTTCGTGCTGATCCTCGCATTTGAAATTCCGAAGTTTGCGTCGATGTTCGGGGGTGGG
GCAAGCGCGAGCGGCTCGGCGTTCAAGAGCCTGACGAAGATGGCGACCAAGGGGTTGGCGTAA
 Primer design