SecReT4
Protein ID: 189348784
T4SS name [ID]Tra_F [805]
Gene symboltraF
Locus tagBMULJ_06198
StrainBurkholderia multivorans ATCC 17616
Repliconplasmid pTGL1 [GenBank: NC_010802] [Browse all T4SS(s) in this replicon]
Location [Strand]27570..28586 [+]
Productputative type IV secretion system protein
Component typeTraF_F
UniProt IDA9AU09
KEGG IDbmj:BMULJ_06198, bmu:Bmul_6222
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 6.7e-58, Aligned region: 47..280
Protein Sequence: 338 a.a.     [Download]
>gi|189348784|ref|YP_001941979.1| putative type IV secretion system protein [Burkholderia multivorans ATCC 17616]
MHTACFDIARGRRIAQWIALALLPVSIHVVAAPATDSPRGDAYGDAFLNYQPYVTPAAPVQASAPASKPP
TQTAPAPATVAETGPQKVDVVFLRKVYPVLEERAINDPTDANISAYMYTKRIILDKAQRFSQSVARVLRQ
DPLLDENNRVPYASTGALSVRNADYQAQQKAVEELARIGGLVAFVDSTCRFCAMQIPVLDMLKRAHKIEY
LVVSLDGARPKGFNGPLISDNGLFRKLGLKLTPSIVFVPRPRAYVGADDPNRYLVVSQGFYAMDELVKQI
AYAGHDTKLLSAEVMRDLNVWDRGVTTTQDLNKLRLDPNKPGSFREILQPYLLKQYQN
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|189348761|ref|NC_010802.1|:27570-28586 Burkholderia multivorans ATCC 17616 plasmid pTGL1, complete sequence
ATGCATACCGCCTGTTTTGACATCGCGCGCGGTCGGCGCATTGCCCAATGGATCGCGCTCGCCCTGCTGC
CAGTCTCGATCCACGTCGTCGCGGCGCCAGCGACTGACTCGCCACGGGGTGACGCATACGGCGATGCTTT
CCTCAACTATCAGCCTTACGTCACACCAGCTGCGCCCGTCCAAGCCTCCGCACCCGCGTCTAAGCCGCCC
ACACAAACGGCGCCAGCGCCAGCTACAGTAGCCGAGACGGGCCCCCAAAAAGTCGACGTAGTCTTTCTTC
GAAAGGTTTACCCGGTGCTAGAAGAGCGGGCGATCAATGACCCCACCGACGCCAATATCTCGGCGTACAT
GTATACGAAGCGCATTATTCTCGACAAGGCTCAACGATTCTCTCAGAGCGTTGCGCGTGTGCTTAGGCAG
GACCCGTTACTCGACGAAAACAACCGGGTTCCGTATGCCTCGACCGGAGCGCTATCTGTACGCAACGCCG
ACTATCAAGCTCAACAAAAGGCCGTGGAAGAGCTCGCCCGCATCGGCGGGCTTGTCGCCTTCGTCGACAG
TACATGCCGGTTCTGCGCAATGCAGATCCCTGTCCTCGACATGCTCAAACGCGCGCACAAGATCGAGTAT
CTGGTGGTGTCGCTTGACGGTGCTCGCCCTAAGGGATTTAACGGCCCGCTCATCTCAGATAACGGTCTGT
TTCGAAAACTCGGGCTGAAACTAACGCCCTCCATCGTCTTCGTTCCCCGGCCTCGCGCATATGTCGGGGC
CGACGATCCTAACCGTTATCTGGTGGTGTCCCAAGGGTTCTATGCGATGGACGAACTCGTTAAACAGATC
GCGTACGCTGGTCACGATACGAAGCTGTTAAGCGCGGAGGTAATGCGCGATCTCAACGTCTGGGACCGTG
GCGTAACGACTACACAGGACCTCAACAAGCTGAGGCTCGATCCGAACAAGCCAGGCTCGTTCCGCGAGAT
CCTTCAGCCGTACCTCTTGAAGCAATACCAGAACTAA
 Primer design