SecReT4
Protein ID: 189349744
T4SS name [ID]Trb [324]
Gene symboltrbG
Locus tagBMULJ_00883
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome 1 [GenBank: NC_010804] [Browse all T4SS(s) in this replicon]
Location [Strand]956740..957741 [-]
Producttype IV secretion system protein
Component typeTrbG
UniProt IDA9AED6
KEGG IDbmj:BMULJ_00883, bmu:Bmul_2358
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.7e-68, Aligned region: 103..322
Protein Sequence: 333 a.a.     [Download]
>gi|189349744|ref|YP_001945372.1| type IV secretion system protein [Burkholderia multivorans ATCC 17616]
MNLPFRFYAFVLMFAALSGCASQGKPPPTISLDEPVQAQPLPEPPKPVEVVAVPEPLALPAQLKPLPKLD
EAATAPEPADEKMRVSRANAEARIAPTREGYVNAIQVWPYSDGALYQVYAAPGRVTVVSLQPGEELVTVA
AGDTVRWIVGDTSSGSGEALRVNVLVKPTRSGLKTNLVITTSRRTYLLELTSTEKAWMASVSWDYPKDRM
LALQRQAQAAQTAAPVDTGLALEKIRFRYTISGSNPPWKPQRAFDDGEKVYIQFPPGIAQGELPPLFVIG
AQGDGQLVNYRFRSPYYIVDRLFGAAELRLGGDGGDVVRIERTDGAVGAARRN
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|189348893|ref|NC_010804.1|:c957741-956740 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGAACCTGCCTTTCCGCTTTTACGCTTTCGTGCTGATGTTCGCAGCTCTGTCGGGTTGCGCCTCGCAAG
GCAAGCCACCGCCGACCATCTCGCTCGATGAGCCAGTGCAGGCGCAGCCGCTGCCCGAACCGCCCAAGCC
GGTCGAAGTCGTCGCCGTGCCCGAGCCACTGGCGCTGCCGGCGCAGTTGAAGCCGCTGCCGAAGCTGGAC
GAGGCAGCGACCGCGCCGGAGCCGGCCGACGAGAAGATGCGCGTCTCGCGCGCCAATGCCGAGGCGCGCA
TCGCGCCGACCCGCGAGGGCTACGTCAACGCGATTCAGGTGTGGCCGTATAGCGACGGCGCGTTGTATCA
GGTCTATGCGGCACCGGGGCGCGTCACCGTGGTTTCGCTCCAGCCTGGCGAGGAACTGGTGACGGTCGCC
GCTGGCGATACCGTGCGCTGGATCGTCGGCGACACGTCCAGCGGCAGCGGCGAGGCGTTGCGCGTCAATG
TGCTAGTCAAGCCCACCCGTTCGGGCCTGAAAACCAATCTGGTCATCACCACCAGCCGGCGGACGTACCT
GCTGGAACTGACTTCGACCGAGAAGGCATGGATGGCCTCGGTGTCATGGGACTACCCGAAAGACCGGATG
CTGGCCTTGCAGCGCCAGGCGCAGGCTGCACAGACAGCCGCGCCGGTCGATACCGGCCTGGCGTTGGAGA
AGATCCGCTTCCGCTACACGATCAGCGGCAGCAATCCGCCGTGGAAGCCGCAGCGGGCCTTCGATGATGG
CGAGAAGGTCTACATCCAGTTCCCGCCGGGCATCGCGCAAGGCGAACTGCCGCCGCTGTTCGTCATCGGC
GCGCAGGGTGACGGGCAACTGGTCAATTACCGTTTCCGTTCGCCGTACTACATCGTGGATCGACTCTTTG
GTGCGGCCGAACTGCGCCTGGGTGGCGATGGTGGTGACGTGGTGCGGATCGAGCGCACCGACGGGGCTGT
GGGCGCAGCGCGGAGGAACTGA
 Primer design