SecReT4
Protein ID: 189349746
T4SS name [ID]Trb [324]
Gene symboltrbL
Locus tagBMULJ_00885
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome 1 [GenBank: NC_010804] [Browse all T4SS(s) in this replicon]
Location [Strand]958467..959849 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA9AED4
KEGG IDbmj:BMULJ_00885, bmu:Bmul_2356
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 8.9e-50, Aligned region: 37..264
Protein Sequence: 460 a.a.     [Download]
>gi|189349746|ref|YP_001945374.1| conjugal transfer protein TrbL [Burkholderia multivorans ATCC 17616]
MNDVTIIDRFLDTFSRYIDSGFGLLQGEVAFLTATLIVIDMTIAGLYWAMSQATGQGEDVIAKLLRKVLY
VGAFAYIIGNFNWLASIVFRSFAGLGLTATGSTMTMENFLQPGRLAKTGIDAGAPILEQIGNMAGFPEVF
VNIDPIVVMFLAWLTVILCFFVLAIQLFITLIEFKLTTLAGFVLVPFALWNKTSFLAEKVLGNVVSSGIK
VLVLAVIVGIGSGLFAEFQVHPDEPSIDHALVVMLASLALLALGIYGPGIATGLVSGAPQLGAGAMAGAA
VGAAGTAVAIGAAATGVGGAVMAGARMAPAAAKLAGAGARAATSVAGGAKSAFQEGSAAAGGGAKGAKAG
LGNVAKTGAQSAGRSAASGASGAAQKMTGSFRAGLNGTEAGGDAASGAAGAGQAAADGTASSQKQAQPAW
AKRMHRRQQITHAATTAAHTLRGGDGGGSGQGPSLRGSDD
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|189348893|ref|NC_010804.1|:c959849-958467 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGAACGACGTGACCATCATCGACCGTTTCCTCGATACGTTCTCCCGCTACATCGACTCCGGGTTCGGCC
TGCTGCAAGGCGAAGTGGCGTTCCTGACGGCTACGCTGATCGTCATCGACATGACCATCGCGGGCCTGTA
TTGGGCCATGAGCCAGGCCACTGGCCAGGGCGAGGACGTGATCGCCAAGCTGCTGCGTAAGGTGCTCTAC
GTCGGTGCCTTCGCCTACATCATCGGCAACTTCAACTGGCTGGCCAGCATCGTCTTCCGCTCGTTTGCTG
GACTGGGCCTGACGGCCACCGGCTCGACCATGACGATGGAGAACTTTCTGCAACCAGGGCGGCTAGCCAA
GACCGGTATCGACGCCGGCGCGCCGATTCTGGAGCAGATCGGCAACATGGCGGGCTTCCCCGAAGTCTTC
GTGAATATCGACCCCATCGTGGTGATGTTCCTCGCCTGGCTCACCGTGATCCTGTGTTTCTTCGTGCTGG
CGATCCAGCTTTTCATCACGCTGATCGAGTTCAAGCTGACCACGCTCGCGGGCTTCGTGCTGGTGCCGTT
CGCGCTGTGGAACAAGACCTCGTTTCTCGCCGAAAAGGTACTCGGCAACGTGGTGTCGTCGGGCATCAAG
GTCTTGGTGCTGGCTGTCATCGTCGGCATCGGTTCGGGCCTGTTCGCGGAGTTCCAGGTTCACCCCGACG
AACCCTCCATCGATCACGCCCTTGTCGTGATGCTGGCCTCGCTCGCGCTGCTGGCGCTGGGCATCTATGG
GCCGGGCATCGCAACCGGCCTGGTGTCTGGTGCGCCGCAGCTTGGCGCCGGCGCGATGGCGGGTGCCGCT
GTCGGTGCCGCCGGCACAGCCGTTGCCATCGGTGCCGCCGCGACCGGCGTGGGCGGTGCGGTCATGGCCG
GGGCACGCATGGCGCCGGCGGCCGCGAAGCTGGCCGGCGCCGGTGCGCGTGCCGCCACGTCGGTCGCCGG
CGGCGCAAAATCGGCATTCCAAGAGGGTTCCGCCGCTGCGGGCGGCGGCGCCAAGGGTGCGAAGGCCGGC
TTGGGCAATGTCGCCAAGACCGGCGCGCAGTCTGCCGGGCGCAGCGCCGCATCTGGCGCGTCCGGCGCAG
CGCAGAAGATGACCGGCTCTTTCCGCGCTGGATTGAACGGTACAGAGGCCGGTGGCGACGCTGCGTCCGG
TGCGGCTGGCGCCGGCCAGGCAGCCGCAGACGGCACCGCCAGCTCGCAGAAGCAAGCGCAGCCCGCATGG
GCCAAGCGGATGCACCGCCGCCAGCAGATCACCCATGCCGCGACCACTGCCGCACACACGTTGCGCGGCG
GCGATGGCGGCGGCTCCGGGCAAGGCCCGAGCCTGCGCGGCTCCGACGACTGA
 Primer design