SecReT4
Protein ID: 189349751
T4SS name [ID]Trb [324]
Gene symboltrbC
Locus tagBMULJ_00890
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome 1 [GenBank: NC_010804] [Browse all T4SS(s) in this replicon]
Location [Strand]963628..964005 [-]
Producttype IV secretion system protein
Component typeTrbC
UniProt IDA9AEC9
KEGG IDbmj:BMULJ_00890, bmu:Bmul_2351
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.4e-23, Aligned region: 26..115
Protein Sequence: 125 a.a.     [Download]
>gi|189349751|ref|YP_001945379.1| type IV secretion system protein [Burkholderia multivorans ATCC 17616]
MTHVDAFRLSVNPHPSLARLRLLARPAAQGLLLAALMLLLAGTAQAAGSSMPWEGPLTSILESIQGPVAR
IVAVIIIISTGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 378 bp     [Download]
>gi|189348893|ref|NC_010804.1|:c964005-963628 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGACGCACGTTGATGCTTTCCGTCTTTCCGTAAATCCGCATCCCAGTCTCGCAAGACTGCGCCTCCTGG
CTCGCCCTGCCGCACAGGGACTGCTGCTGGCCGCACTGATGTTGCTGCTGGCCGGCACGGCGCAGGCCGC
CGGTTCCAGCATGCCGTGGGAAGGTCCGCTGACCTCCATCCTCGAATCGATCCAGGGGCCAGTGGCCCGG
ATCGTGGCGGTGATCATCATCATTTCCACCGGACTGGCGTTGGCGTTCGGCGACACCAGCGGGGGCTTTC
GCAAGCTGATCCAGATCGTGTTCGGCCTGTCCATCGCGTTCGCCGCGTCCTCGTTCTTCCTGTCGTTCTT
CAGCTTCTCCGGCGGGGCCGTCGTATGA
 Primer design